Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54536
Gene name	Exocyst complex component 6
Gene symbol	EXOC6
Synonyms (NCBI Gene)	EXOC6ASEC15SEC15LSEC15L1SEC15L3Sec15p
Chromosome	10
Chromosome location	10q23.33
Summary	The protein encoded by this gene is highly similar to the Saccharomyces cerevisiae SEC15 gene product, which is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex re

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019705	hsa-miR-375	Microarray	20215506
MIRT049903	hsa-miR-31-5p	CLASH	23622248
MIRT178387	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT639377	hsa-miR-1206	HITS-CLIP	23824327
MIRT639376	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT019705	hsa-miR-375	HITS-CLIP	23824327
MIRT639375	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT178387	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT639377	hsa-miR-1206	HITS-CLIP	23824327
MIRT019705	hsa-miR-375	HITS-CLIP	23824327
MIRT639375	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT178387	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT639377	hsa-miR-1206	HITS-CLIP	23824327
MIRT639376	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT019705	hsa-miR-375	HITS-CLIP	23824327
MIRT639375	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT178387	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT639377	hsa-miR-1206	HITS-CLIP	23824327
MIRT639376	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT019705	hsa-miR-375	HITS-CLIP	23824327
MIRT639375	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT178387	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT639377	hsa-miR-1206	HITS-CLIP	23824327
MIRT019705	hsa-miR-375	HITS-CLIP	23824327
MIRT639375	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT178387	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT639377	hsa-miR-1206	HITS-CLIP	23824327
MIRT639376	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT019705	hsa-miR-375	HITS-CLIP	23824327
MIRT639375	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT972813	hsa-miR-105	CLIP-seq
MIRT972814	hsa-miR-1178	CLIP-seq
MIRT972815	hsa-miR-1183	CLIP-seq
MIRT972816	hsa-miR-1243	CLIP-seq
MIRT972817	hsa-miR-1290	CLIP-seq
MIRT972818	hsa-miR-1305	CLIP-seq
MIRT972819	hsa-miR-2054	CLIP-seq
MIRT972820	hsa-miR-3065-5p	CLIP-seq
MIRT972821	hsa-miR-30a	CLIP-seq
MIRT972822	hsa-miR-30b	CLIP-seq
MIRT972823	hsa-miR-30c	CLIP-seq
MIRT972824	hsa-miR-30d	CLIP-seq
MIRT972825	hsa-miR-30e	CLIP-seq
MIRT972826	hsa-miR-3130-3p	CLIP-seq
MIRT972827	hsa-miR-3163	CLIP-seq
MIRT972828	hsa-miR-3167	CLIP-seq
MIRT972829	hsa-miR-3607-3p	CLIP-seq
MIRT972830	hsa-miR-3616-5p	CLIP-seq
MIRT972831	hsa-miR-3622a-3p	CLIP-seq
MIRT972832	hsa-miR-3622b-3p	CLIP-seq
MIRT972833	hsa-miR-3647-5p	CLIP-seq
MIRT972834	hsa-miR-3671	CLIP-seq
MIRT972835	hsa-miR-3686	CLIP-seq
MIRT972836	hsa-miR-410	CLIP-seq
MIRT972837	hsa-miR-421	CLIP-seq
MIRT972838	hsa-miR-4307	CLIP-seq
MIRT972839	hsa-miR-4320	CLIP-seq
MIRT972840	hsa-miR-4438	CLIP-seq
MIRT972841	hsa-miR-4463	CLIP-seq
MIRT972842	hsa-miR-4650-5p	CLIP-seq
MIRT972843	hsa-miR-4693-5p	CLIP-seq
MIRT972844	hsa-miR-4778-5p	CLIP-seq
MIRT972845	hsa-miR-4795-5p	CLIP-seq
MIRT972846	hsa-miR-5095	CLIP-seq
MIRT972847	hsa-miR-522	CLIP-seq
MIRT972848	hsa-miR-548u	CLIP-seq
MIRT972849	hsa-miR-573	CLIP-seq
MIRT972850	hsa-miR-587	CLIP-seq
MIRT972851	hsa-miR-600	CLIP-seq
MIRT972852	hsa-miR-605	CLIP-seq
MIRT972853	hsa-miR-607	CLIP-seq
MIRT972854	hsa-miR-876-5p	CLIP-seq
MIRT1988255	hsa-miR-23a	CLIP-seq
MIRT1988256	hsa-miR-23b	CLIP-seq
MIRT1988257	hsa-miR-23c	CLIP-seq
MIRT1988258	hsa-miR-4291	CLIP-seq
MIRT1988259	hsa-miR-4699-5p	CLIP-seq
MIRT1988260	hsa-miR-4719	CLIP-seq
MIRT1988261	hsa-miR-4756-3p	CLIP-seq
MIRT1988262	hsa-miR-4760-3p	CLIP-seq
MIRT1988263	hsa-miR-520a-5p	CLIP-seq
MIRT1988264	hsa-miR-525-5p	CLIP-seq
MIRT1988265	hsa-miR-550b	CLIP-seq
MIRT1988266	hsa-miR-889	CLIP-seq
MIRT2222724	hsa-miR-3180-5p	CLIP-seq
MIRT2222725	hsa-miR-4464	CLIP-seq
MIRT2222726	hsa-miR-4748	CLIP-seq
MIRT1988263	hsa-miR-520a-5p	CLIP-seq
MIRT1988264	hsa-miR-525-5p	CLIP-seq
MIRT2222727	hsa-miR-579	CLIP-seq
MIRT2526378	hsa-miR-3185	CLIP-seq
MIRT2526379	hsa-miR-4709-3p	CLIP-seq
MIRT2526380	hsa-miR-490-3p	CLIP-seq
MIRT2526381	hsa-miR-548a-5p	CLIP-seq
MIRT2526382	hsa-miR-548ab	CLIP-seq
MIRT2526383	hsa-miR-548ak	CLIP-seq
MIRT2526384	hsa-miR-548b-5p	CLIP-seq
MIRT2526385	hsa-miR-548c-5p	CLIP-seq
MIRT2526386	hsa-miR-548d-5p	CLIP-seq
MIRT2526387	hsa-miR-548h	CLIP-seq
MIRT2526388	hsa-miR-548i	CLIP-seq
MIRT2526389	hsa-miR-548j	CLIP-seq
MIRT2526390	hsa-miR-548w	CLIP-seq
MIRT2526391	hsa-miR-548y	CLIP-seq
MIRT2526392	hsa-miR-559	CLIP-seq
MIRT2526393	hsa-miR-649	CLIP-seq
MIRT2526378	hsa-miR-3185	CLIP-seq
MIRT2526379	hsa-miR-4709-3p	CLIP-seq
MIRT2526380	hsa-miR-490-3p	CLIP-seq
MIRT2526381	hsa-miR-548a-5p	CLIP-seq
MIRT2526382	hsa-miR-548ab	CLIP-seq
MIRT2526383	hsa-miR-548ak	CLIP-seq
MIRT2526384	hsa-miR-548b-5p	CLIP-seq
MIRT2526385	hsa-miR-548c-5p	CLIP-seq
MIRT2526386	hsa-miR-548d-5p	CLIP-seq
MIRT2526387	hsa-miR-548h	CLIP-seq
MIRT2526388	hsa-miR-548i	CLIP-seq
MIRT2526389	hsa-miR-548j	CLIP-seq
MIRT2526390	hsa-miR-548w	CLIP-seq
MIRT2526391	hsa-miR-548y	CLIP-seq
MIRT2526392	hsa-miR-559	CLIP-seq
MIRT2526393	hsa-miR-649	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000145	Component	Exocyst	IBA
GO:0000145	Component	Exocyst	NAS	22420621
GO:0000281	Process	Mitotic cytokinesis	NAS	22420621
GO:0005515	Function	Protein binding	IPI	25556234, 27173435, 28514442, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006887	Process	Exocytosis	IBA
GO:0006887	Process	Exocytosis	IEA
GO:0006893	Process	Golgi to plasma membrane transport	IBA
GO:0006904	Process	Vesicle docking involved in exocytosis	NAS	22420621
GO:0015031	Process	Protein transport	IEA
GO:0030426	Component	Growth cone	IEA
GO:0042995	Component	Cell projection	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0090148	Process	Membrane fission	NAS	22420621
GO:0090522	Process	Vesicle tethering involved in exocytosis	IEA
GO:0090522	Process	Vesicle tethering involved in exocytosis	NAS	22420621
GO:0090543	Component	Flemming body	IEA

MIM	HGNC	e!Ensembl
609672	23196	ENSG00000138190

Q8TAG9

Protein name

Exocyst complex component 6 (Exocyst complex component Sec15A) (SEC15-like protein 1)

Protein function

Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane. Together with RAB11A, RAB3IP, RAB8A, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membra

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04091	Sec15	456 → 762	Exocyst complex subunit Sec15-like	Family

Sequence

MAENSESLGTVPEHERILQEIESTDTACVGPTLRSVYDDQPNAHKKFMEKLDACIRNHDK
EIEKMCNFHHQGFVDAITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIVHTEDIIRCRI
QQRNITTVVEKLQLCLPVLEMYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQL
MIENLPKLREDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQHQKTFSVSLQKQNKMKF
GKNMYINRDRIPEERNETVLKHSLEEEDENEEEILTVQDLVDFSPVYRCLHIYSVLGDEE
TFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRAY
TDELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLTVIFADTLQGYGFPVNRLFDLLFEI
RDQYNETLLKKWAGVFRDIFEEDNYSPIPVVNEEEYKIVISKFPFQDPDLEKQSFPKKFP
MSQSVPHIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKP
HIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLSTFKDARHAAEGE
IYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINFLRSIFQVFTHLPGKVAQTACM
SACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFID
LRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKKNNIFAQFRKNDR
DKQKLIETVVKQLRSLVNGMSQHM

Sequence length

804

Interactions

View interactions

	Reactome
			Insulin processing VxPx cargo-targeting to cilium

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE LARGE B-CELL LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOLLICULAR LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	28798985, 35265226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	38087213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	26818947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	28798985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EXOC6 (exocyst complex component 6)