ZDHHC13 (zDHHC palmitoyltransferase 13)

Gene

• Entrez ID: 54503
• Gene name: ZDHHC palmitoyltransferase 13
• Gene symbol: ZDHHC13
• Synonyms (NCBI Gene): HIP14L, HIP3RP
• Chromosome: 11
• Chromosome location: 11p15.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1507716	hsa-miR-146a	CLIP-seq
MIRT1507717	hsa-miR-146b-5p	CLIP-seq
MIRT1507718	hsa-miR-2054	CLIP-seq
MIRT1507719	hsa-miR-361-5p	CLIP-seq
MIRT1507720	hsa-miR-365	CLIP-seq
MIRT1507721	hsa-miR-4263	CLIP-seq
MIRT1507722	hsa-miR-4461	CLIP-seq
MIRT1507723	hsa-miR-4766-3p	CLIP-seq
MIRT1507724	hsa-miR-4799-5p	CLIP-seq
MIRT1507725	hsa-miR-532-5p	CLIP-seq
MIRT1507726	hsa-miR-548p	CLIP-seq
MIRT1507727	hsa-miR-576-5p	CLIP-seq
MIRT1507728	hsa-miR-580	CLIP-seq
MIRT1507729	hsa-miR-589	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	16647879
GO:0005794	Component	Golgi apparatus	IEA
GO:0015095	Function	Magnesium ion transmembrane transporter activity	IEA
GO:0015095	Function	Magnesium ion transmembrane transporter activity	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016409	Function	Palmitoyltransferase activity	IEA
GO:0016409	Function	Palmitoyltransferase activity	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030660	Component	Golgi-associated vesicle membrane	IEA
GO:0030660	Component	Golgi-associated vesicle membrane	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:1903830	Process	Magnesium ion transmembrane transport	IEA

Other IDs

• MIM: 612815
• HGNC: 18413
• e!Ensembl: ENSG00000177054

Protein

• UniProt ID: Q8IUH4
• Protein name: Palmitoyltransferase ZDHHC13 (EC 2.3.1.225) (Huntingtin-interacting protein 14-related protein) (HIP14-related protein) (Huntingtin-interacting protein HIP3RP) (Putative MAPK-activating protein PM03) (Putative NF-kappa-B-activating protein 209) (Zinc fing
• Protein function: Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates (By similarity). Palmitoyltransferase for HTT and GAD2. May play a role in Mg(2+) transport.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12796	Ank_2	53 → 146	Ankyrin repeats (3 copies)	Repeat
  PF13637	Ank_4	217 → 271		Repeat
  PF01529	DHHC	421 → 559	DHHC palmitoyltransferase	Family

• Sequence:

  MEGPGLGSQCRNHSHGPHPPGFGRYGICAHENKELANAREALPLIEDSSNCDIVKATQYG
  IFERCKELVEAGYDVRQPDKENVSLLHWAAINNRLDLVKFYISKGAVVDQLGGDLNSTPL
  HWAIRQGHLPMVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV
  NGQTPLMLSAHKVIGPEPTGFLLKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVDKLLEAG
  SSLDIQNVKGETPLDMALQNKNQLIIHMLKTEAKMRANQKFRLWRWLQKCELFLLLMLSV
  ITMWAIGYILDFNSDSWLLKGCLLVTLFFLTSLFPRFLVGYKNLVYLPTAFLLSSVFWIF
  MTWFILFFPDLAGAPFYFSFIFSIVAFLYFFYKTWATDPGFTKASEEEKKVNIITLAETG
  SLDFRTFCTSCLIRKPLRSLHCHVCNCCVARYDQHCLWTGRCIGFGNHHYYIFFLFFLSM
  VCGWIIYGSFIYLSSHCATTFKEDGLWTYLNQIVACSPWVLYILMLATFHFSWSTFLLLN
  QLFQIAFLGLTSHERISLQKQSKHMKQTLSLRKTPYNLGFMQNLADFFQCGCFGLVKPCV
  VDWTSQYTMVFHPAREKVLRSV

• Sequence length: 622

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYLOIDOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alopecia	Alopecia	CTD_human_DG	20548961		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	24637783		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	CTD_human_DG	20548961		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	CTD_human_DG	20548961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Androgenetic Alopecia	Androgenetic Alopecia	CTD_human_DG	20548961		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28017833, 31669413		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	28017833		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28017833		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22155432, 25849918		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28017833, 31669413		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	20548961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	28526873		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	20548961		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	20548961		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	20548961		★☆☆☆☆ Found in Text Mining only
Pseudopelade	Pseudopelade	CTD_human_DG	20548961		★☆☆☆☆ Found in Text Mining only