Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	5450
Gene name	POU class 2 homeobox associating factor 1
Gene symbol	POU2AF1
Synonyms (NCBI Gene)	BOB1OBF-1OBF1OCAB
Chromosome	11
Chromosome location	11q23.1

253

Show/Hide all (253)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439929	ebv-miR-BART4-5p	HITS-CLIP	22473208
MIRT439928	hsa-miR-210-3p	HITS-CLIP	22473208
MIRT439929	ebv-miR-BART4-5p	HITS-CLIP	22473208
MIRT726902	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT726901	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT726900	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT726899	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT439928	hsa-miR-210-3p	HITS-CLIP	22473208
MIRT1250513	hsa-miR-1252	CLIP-seq
MIRT1250514	hsa-miR-1254	CLIP-seq
MIRT1250515	hsa-miR-1269	CLIP-seq
MIRT1250516	hsa-miR-1269b	CLIP-seq
MIRT1250517	hsa-miR-1275	CLIP-seq
MIRT1250518	hsa-miR-1288	CLIP-seq
MIRT1250519	hsa-miR-1321	CLIP-seq
MIRT1250520	hsa-miR-15a	CLIP-seq
MIRT1250521	hsa-miR-15b	CLIP-seq
MIRT1250522	hsa-miR-16	CLIP-seq
MIRT1250523	hsa-miR-186	CLIP-seq
MIRT1250524	hsa-miR-195	CLIP-seq
MIRT1250525	hsa-miR-2278	CLIP-seq
MIRT1250526	hsa-miR-2392	CLIP-seq
MIRT1250527	hsa-miR-24	CLIP-seq
MIRT1250528	hsa-miR-2467-5p	CLIP-seq
MIRT1250529	hsa-miR-3116	CLIP-seq
MIRT1250530	hsa-miR-3125	CLIP-seq
MIRT1250531	hsa-miR-3133	CLIP-seq
MIRT1250532	hsa-miR-3145-5p	CLIP-seq
MIRT1250533	hsa-miR-3154	CLIP-seq
MIRT1250534	hsa-miR-3173-3p	CLIP-seq
MIRT1250535	hsa-miR-3175	CLIP-seq
MIRT1250536	hsa-miR-3185	CLIP-seq
MIRT1250537	hsa-miR-3202	CLIP-seq
MIRT1250538	hsa-miR-3607-3p	CLIP-seq
MIRT1250539	hsa-miR-3690	CLIP-seq
MIRT1250540	hsa-miR-378	CLIP-seq
MIRT1250541	hsa-miR-378b	CLIP-seq
MIRT1250542	hsa-miR-378c	CLIP-seq
MIRT1250543	hsa-miR-378d	CLIP-seq
MIRT1250544	hsa-miR-378e	CLIP-seq
MIRT1250545	hsa-miR-378f	CLIP-seq
MIRT1250546	hsa-miR-378h	CLIP-seq
MIRT1250547	hsa-miR-378i	CLIP-seq
MIRT1250548	hsa-miR-3916	CLIP-seq
MIRT1250549	hsa-miR-3978	CLIP-seq
MIRT1250550	hsa-miR-422a	CLIP-seq
MIRT1250551	hsa-miR-424	CLIP-seq
MIRT1250552	hsa-miR-4269	CLIP-seq
MIRT1250553	hsa-miR-4271	CLIP-seq
MIRT1250554	hsa-miR-4284	CLIP-seq
MIRT1250555	hsa-miR-4311	CLIP-seq
MIRT1250556	hsa-miR-4419a	CLIP-seq
MIRT1250557	hsa-miR-4428	CLIP-seq
MIRT1250558	hsa-miR-4434	CLIP-seq
MIRT1250559	hsa-miR-4466	CLIP-seq
MIRT1250560	hsa-miR-4476	CLIP-seq
MIRT1250561	hsa-miR-4510	CLIP-seq
MIRT1250562	hsa-miR-4514	CLIP-seq
MIRT1250563	hsa-miR-4515	CLIP-seq
MIRT1250564	hsa-miR-4516	CLIP-seq
MIRT1250565	hsa-miR-4525	CLIP-seq
MIRT1250566	hsa-miR-4533	CLIP-seq
MIRT1250567	hsa-miR-4665-5p	CLIP-seq
MIRT1250568	hsa-miR-4679	CLIP-seq
MIRT1250569	hsa-miR-4692	CLIP-seq
MIRT1250570	hsa-miR-4722-5p	CLIP-seq
MIRT1250571	hsa-miR-4723-5p	CLIP-seq
MIRT1250572	hsa-miR-4725-3p	CLIP-seq
MIRT1250573	hsa-miR-4728-5p	CLIP-seq
MIRT1250574	hsa-miR-4739	CLIP-seq
MIRT1250575	hsa-miR-4740-5p	CLIP-seq
MIRT1250576	hsa-miR-4742-5p	CLIP-seq
MIRT1250577	hsa-miR-4746-3p	CLIP-seq
MIRT1250578	hsa-miR-4747-5p	CLIP-seq
MIRT1250579	hsa-miR-4756-5p	CLIP-seq
MIRT1250580	hsa-miR-4768-3p	CLIP-seq
MIRT1250581	hsa-miR-497	CLIP-seq
MIRT1250582	hsa-miR-508-5p	CLIP-seq
MIRT1250583	hsa-miR-545	CLIP-seq
MIRT1250584	hsa-miR-548aa	CLIP-seq
MIRT1250585	hsa-miR-548p	CLIP-seq
MIRT1250586	hsa-miR-625	CLIP-seq
MIRT1250587	hsa-miR-661	CLIP-seq
MIRT1250588	hsa-miR-675	CLIP-seq
MIRT1250589	hsa-miR-767-5p	CLIP-seq
MIRT1250590	hsa-miR-940	CLIP-seq
MIRT1552504	hsa-miR-3689a-3p	CLIP-seq
MIRT1552505	hsa-miR-3689c	CLIP-seq
MIRT2073956	hsa-miR-1246	CLIP-seq
MIRT1250513	hsa-miR-1252	CLIP-seq
MIRT1250533	hsa-miR-3154	CLIP-seq
MIRT1250534	hsa-miR-3173-3p	CLIP-seq
MIRT2073957	hsa-miR-3921	CLIP-seq
MIRT2073958	hsa-miR-3926	CLIP-seq
MIRT2073959	hsa-miR-3929	CLIP-seq
MIRT2073960	hsa-miR-3974	CLIP-seq
MIRT2073961	hsa-miR-4251	CLIP-seq
MIRT2073962	hsa-miR-4320	CLIP-seq
MIRT2073963	hsa-miR-4329	CLIP-seq
MIRT2073964	hsa-miR-4419b	CLIP-seq
MIRT2073965	hsa-miR-4433	CLIP-seq
MIRT2073966	hsa-miR-4457	CLIP-seq
MIRT2073967	hsa-miR-4459	CLIP-seq
MIRT1250560	hsa-miR-4476	CLIP-seq
MIRT2073968	hsa-miR-4478	CLIP-seq
MIRT1250566	hsa-miR-4533	CLIP-seq
MIRT2073969	hsa-miR-4653-5p	CLIP-seq
MIRT1250568	hsa-miR-4679	CLIP-seq
MIRT2073970	hsa-miR-4714-5p	CLIP-seq
MIRT1250578	hsa-miR-4747-5p	CLIP-seq
MIRT2073971	hsa-miR-4767	CLIP-seq
MIRT1250580	hsa-miR-4768-3p	CLIP-seq
MIRT2073972	hsa-miR-4786-5p	CLIP-seq
MIRT2073973	hsa-miR-4802-3p	CLIP-seq
MIRT2073974	hsa-miR-485-5p	CLIP-seq
MIRT2073975	hsa-miR-490-5p	CLIP-seq
MIRT2073976	hsa-miR-513b	CLIP-seq
MIRT2073977	hsa-miR-548s	CLIP-seq
MIRT2073978	hsa-miR-617	CLIP-seq
MIRT2073979	hsa-miR-624	CLIP-seq
MIRT2300879	hsa-miR-122	CLIP-seq
MIRT2300880	hsa-miR-125a-3p	CLIP-seq
MIRT2300881	hsa-miR-1285	CLIP-seq
MIRT2300882	hsa-miR-2116	CLIP-seq
MIRT1250527	hsa-miR-24	CLIP-seq
MIRT1250532	hsa-miR-3145-5p	CLIP-seq
MIRT2300883	hsa-miR-3183	CLIP-seq
MIRT2300884	hsa-miR-3187-5p	CLIP-seq
MIRT2300885	hsa-miR-3620	CLIP-seq
MIRT2300886	hsa-miR-3622b-5p	CLIP-seq
MIRT2073958	hsa-miR-3926	CLIP-seq
MIRT2300887	hsa-miR-3934	CLIP-seq
MIRT2073960	hsa-miR-3974	CLIP-seq
MIRT2073961	hsa-miR-4251	CLIP-seq
MIRT1250554	hsa-miR-4284	CLIP-seq
MIRT2300888	hsa-miR-4287	CLIP-seq
MIRT2300889	hsa-miR-4300	CLIP-seq
MIRT2073965	hsa-miR-4433	CLIP-seq
MIRT2073966	hsa-miR-4457	CLIP-seq
MIRT2073967	hsa-miR-4459	CLIP-seq
MIRT1250559	hsa-miR-4466	CLIP-seq
MIRT2300890	hsa-miR-4469	CLIP-seq
MIRT1250566	hsa-miR-4533	CLIP-seq
MIRT2300891	hsa-miR-4645-5p	CLIP-seq
MIRT2300892	hsa-miR-4673	CLIP-seq
MIRT2300893	hsa-miR-4676-5p	CLIP-seq
MIRT2300894	hsa-miR-4677-5p	CLIP-seq
MIRT1250568	hsa-miR-4679	CLIP-seq
MIRT2300895	hsa-miR-4685-3p	CLIP-seq
MIRT2300896	hsa-miR-4700-3p	CLIP-seq
MIRT2300897	hsa-miR-4713-5p	CLIP-seq
MIRT2073970	hsa-miR-4714-5p	CLIP-seq
MIRT2300898	hsa-miR-4723-3p	CLIP-seq
MIRT1250577	hsa-miR-4746-3p	CLIP-seq
MIRT2300899	hsa-miR-4755-3p	CLIP-seq
MIRT2073971	hsa-miR-4767	CLIP-seq
MIRT1250580	hsa-miR-4768-3p	CLIP-seq
MIRT2073972	hsa-miR-4786-5p	CLIP-seq
MIRT1250582	hsa-miR-508-5p	CLIP-seq
MIRT2300900	hsa-miR-510	CLIP-seq
MIRT2073976	hsa-miR-513b	CLIP-seq
MIRT2073977	hsa-miR-548s	CLIP-seq
MIRT2300901	hsa-miR-575	CLIP-seq
MIRT2300902	hsa-miR-612	CLIP-seq
MIRT2073979	hsa-miR-624	CLIP-seq
MIRT1250587	hsa-miR-661	CLIP-seq
MIRT1250588	hsa-miR-675	CLIP-seq
MIRT2300903	hsa-miR-764	CLIP-seq
MIRT2300904	hsa-miR-766	CLIP-seq
MIRT1250589	hsa-miR-767-5p	CLIP-seq
MIRT2300905	hsa-miR-920	CLIP-seq
MIRT2456901	hsa-miR-10a	CLIP-seq
MIRT2456902	hsa-miR-10b	CLIP-seq
MIRT2300879	hsa-miR-122	CLIP-seq
MIRT2300881	hsa-miR-1285	CLIP-seq
MIRT2300884	hsa-miR-3187-5p	CLIP-seq
MIRT2456903	hsa-miR-34b	CLIP-seq
MIRT2456904	hsa-miR-3545-3p	CLIP-seq
MIRT2456905	hsa-miR-3614-5p	CLIP-seq
MIRT2300885	hsa-miR-3620	CLIP-seq
MIRT2300886	hsa-miR-3622b-5p	CLIP-seq
MIRT2456906	hsa-miR-3672	CLIP-seq
MIRT1552504	hsa-miR-3689a-3p	CLIP-seq
MIRT1552505	hsa-miR-3689c	CLIP-seq
MIRT2456907	hsa-miR-412	CLIP-seq
MIRT1250552	hsa-miR-4269	CLIP-seq
MIRT1250562	hsa-miR-4514	CLIP-seq
MIRT2300891	hsa-miR-4645-5p	CLIP-seq
MIRT2456908	hsa-miR-4662a-5p	CLIP-seq
MIRT2300892	hsa-miR-4673	CLIP-seq
MIRT2300893	hsa-miR-4676-5p	CLIP-seq
MIRT2456909	hsa-miR-4684-5p	CLIP-seq
MIRT2456910	hsa-miR-4690-3p	CLIP-seq
MIRT1250569	hsa-miR-4692	CLIP-seq
MIRT1250570	hsa-miR-4722-5p	CLIP-seq
MIRT1250576	hsa-miR-4742-5p	CLIP-seq
MIRT2300899	hsa-miR-4755-3p	CLIP-seq
MIRT1250580	hsa-miR-4768-3p	CLIP-seq
MIRT1250582	hsa-miR-508-5p	CLIP-seq
MIRT2456911	hsa-miR-548c-3p	CLIP-seq
MIRT2300901	hsa-miR-575	CLIP-seq
MIRT2300902	hsa-miR-612	CLIP-seq
MIRT1250587	hsa-miR-661	CLIP-seq
MIRT2300904	hsa-miR-766	CLIP-seq
MIRT1250590	hsa-miR-940	CLIP-seq
MIRT2300886	hsa-miR-3622b-5p	CLIP-seq
MIRT2300891	hsa-miR-4645-5p	CLIP-seq
MIRT2456908	hsa-miR-4662a-5p	CLIP-seq
MIRT2300892	hsa-miR-4673	CLIP-seq
MIRT2300893	hsa-miR-4676-5p	CLIP-seq
MIRT2456909	hsa-miR-4684-5p	CLIP-seq
MIRT2300899	hsa-miR-4755-3p	CLIP-seq
MIRT2456911	hsa-miR-548c-3p	CLIP-seq
MIRT2300901	hsa-miR-575	CLIP-seq
MIRT2597647	hsa-miR-140-3p	CLIP-seq
MIRT2597648	hsa-miR-182	CLIP-seq
MIRT2597649	hsa-miR-3619-3p	CLIP-seq
MIRT2300886	hsa-miR-3622b-5p	CLIP-seq
MIRT2597650	hsa-miR-3663-5p	CLIP-seq
MIRT2597651	hsa-miR-3689d	CLIP-seq
MIRT2073965	hsa-miR-4433	CLIP-seq
MIRT2073967	hsa-miR-4459	CLIP-seq
MIRT2597652	hsa-miR-4492	CLIP-seq
MIRT2597653	hsa-miR-4498	CLIP-seq
MIRT2597654	hsa-miR-4508	CLIP-seq
MIRT2597655	hsa-miR-4641	CLIP-seq
MIRT2300891	hsa-miR-4645-5p	CLIP-seq
MIRT2456908	hsa-miR-4662a-5p	CLIP-seq
MIRT2300892	hsa-miR-4673	CLIP-seq
MIRT2300893	hsa-miR-4676-5p	CLIP-seq
MIRT2456909	hsa-miR-4684-5p	CLIP-seq
MIRT2300899	hsa-miR-4755-3p	CLIP-seq
MIRT1250580	hsa-miR-4768-3p	CLIP-seq
MIRT2597656	hsa-miR-4776-5p	CLIP-seq
MIRT2597657	hsa-miR-499a-5p	CLIP-seq
MIRT2597658	hsa-miR-501-3p	CLIP-seq
MIRT2597659	hsa-miR-502-3p	CLIP-seq
MIRT2456911	hsa-miR-548c-3p	CLIP-seq
MIRT2300901	hsa-miR-575	CLIP-seq
MIRT2597660	hsa-miR-626	CLIP-seq
MIRT2597661	hsa-miR-762	CLIP-seq
MIRT2300886	hsa-miR-3622b-5p	CLIP-seq
MIRT2456906	hsa-miR-3672	CLIP-seq
MIRT1250560	hsa-miR-4476	CLIP-seq
MIRT1250566	hsa-miR-4533	CLIP-seq
MIRT2300891	hsa-miR-4645-5p	CLIP-seq
MIRT2456908	hsa-miR-4662a-5p	CLIP-seq
MIRT2300892	hsa-miR-4673	CLIP-seq
MIRT2300893	hsa-miR-4676-5p	CLIP-seq
MIRT2456909	hsa-miR-4684-5p	CLIP-seq
MIRT2300899	hsa-miR-4755-3p	CLIP-seq
MIRT2456911	hsa-miR-548c-3p	CLIP-seq
MIRT2300901	hsa-miR-575	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
POU2F1	Unknown	11847120

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002314	Process	Germinal center B cell differentiation	IEA
GO:0002314	Process	Germinal center B cell differentiation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003712	Function	Transcription coregulator activity	TAS	7859290
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IMP	11380252
GO:0003713	Function	Transcription coactivator activity	ISS
GO:0003713	Function	Transcription coactivator activity	TAS	7859290
GO:0005515	Function	Protein binding	IPI	11483518, 28514442, 32296183, 33961781, 35512704
GO:0005634	Component	Nucleus	IEA
GO:0006959	Process	Humoral immune response	TAS	7859290
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	11380252
GO:0070974	Function	POU domain binding	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	11380252
GO:0090575	Component	RNA polymerase II transcription regulator complex	IMP	10329190
GO:0098586	Process	Cellular response to virus	IEA
GO:0098586	Process	Cellular response to virus	ISS

MIM	HGNC	e!Ensembl
601206	9211	ENSG00000110777

Q16633

Protein name

POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (OCA-B) (OCT-binding factor 1)

Protein function

Transcriptional coactivator that specifically associates with either POU2F1/OCT1 or POU2F2/OCT2 (PubMed:7859290). It boosts the POU2F1/OCT1 mediated promoter activity and to a lesser extent, that of POU2F2/OCT2 (PubMed:7779176). It recognizes th

PDB

1CQT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09310	PD-C2-AF1	7 → 255	POU domain, class 2, associating factor 1	Domain

Tissue specificity

TISSUE SPECIFICITY: B-cell specific (PubMed:7779176, PubMed:7859290). Detected in mainly in spleen, but also in thymus, periphral blood leukocyte and small intestine (PubMed:7779176, PubMed:7859290). {ECO:0000269|PubMed:7779176, ECO:0000269|PubMed:7859290

Sequence

MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATY
TTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSA
DMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWP
QPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEE
DSDAYALNHTLSVEGF

Sequence length

256

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AGAMMAGLOBULINEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (70)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	21905497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24960290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	12670918, 15796964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	BEFREE	10604987		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	34637689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30681271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33004899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27907250, 31103264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	GWASCAT_DG	23000144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32012488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15672409, 8618432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	15672409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	21905497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	21905497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjugated hyperbilirubinemia	Conjugated hyperbilirubinemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatographic urticaria	Dermatographic urticaria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	24332044, 30802265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29578181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	29578181	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	37676284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11154228, 16648862, 21424034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11280769, 12670918, 15796964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	15257313, 16304050	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	15796964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GWASCAT_DG	30194254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	11342448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31600171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	19224997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30476138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34793513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	23000144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37040675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12574333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	14662861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16186795, 28064239, 28345816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16778825, 28064239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	28064239, 30802265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	30802265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	8751468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28053195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17621271, 21438833, 28053195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35288464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16934875		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31770211, 32271791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30476138		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	9427715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cholangitis	Biliary Cholangitis	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	23000144, 28062665		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	ORPHANET_DG	23000144		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	23000144		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASCAT_DG	23000144, 28062665		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31600171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	BEFREE	28982058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27907250, 30681271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	19224997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	LHGDN	17785371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28756244		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	12598320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	24801987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	24801987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

POU2AF1 (POU class 2 homeobox associating factor 1)