Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54487
Gene name	DGCR8 microprocessor complex subunit
Gene symbol	DGCR8
Synonyms (NCBI Gene)	C22orf12DGCRK6Gy1pasha
Chromosome	22
Chromosome location	22q11.21
Summary	This gene encodes a subunit of the microprocessor complex which mediates the biogenesis of microRNAs from the primary microRNA transcript. The encoded protein is a double-stranded RNA binding protein that functions as the non-catalytic subunit of the micr

187

Show/Hide all (187)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051420	hsa-let-7e-5p	CLASH	23622248
MIRT048068	hsa-miR-197-3p	CLASH	23622248
MIRT044120	hsa-miR-30e-3p	CLASH	23622248
MIRT039550	hsa-miR-652-3p	CLASH	23622248
MIRT735015	hsa-miR-126-5p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	33098220
MIRT735369	hsa-miR-451a	MicroarrayNorthern blottingImmunoprecipitaion (IP)qRT-PCR	32302542
MIRT933748	hsa-miR-105	CLIP-seq
MIRT933749	hsa-miR-1226	CLIP-seq
MIRT933750	hsa-miR-1254	CLIP-seq
MIRT933751	hsa-miR-127-5p	CLIP-seq
MIRT933752	hsa-miR-128	CLIP-seq
MIRT933753	hsa-miR-1285	CLIP-seq
MIRT933754	hsa-miR-1292	CLIP-seq
MIRT933755	hsa-miR-1293	CLIP-seq
MIRT933756	hsa-miR-132	CLIP-seq
MIRT933757	hsa-miR-1324	CLIP-seq
MIRT933758	hsa-miR-190	CLIP-seq
MIRT933759	hsa-miR-190b	CLIP-seq
MIRT933760	hsa-miR-196a	CLIP-seq
MIRT933761	hsa-miR-196b	CLIP-seq
MIRT933762	hsa-miR-212	CLIP-seq
MIRT933763	hsa-miR-22	CLIP-seq
MIRT933764	hsa-miR-27a	CLIP-seq
MIRT933765	hsa-miR-27b	CLIP-seq
MIRT933766	hsa-miR-31	CLIP-seq
MIRT933767	hsa-miR-3116	CLIP-seq
MIRT933768	hsa-miR-3126-5p	CLIP-seq
MIRT933769	hsa-miR-3138	CLIP-seq
MIRT933770	hsa-miR-3158-5p	CLIP-seq
MIRT933771	hsa-miR-3166	CLIP-seq
MIRT933772	hsa-miR-3174	CLIP-seq
MIRT933773	hsa-miR-3187-5p	CLIP-seq
MIRT933774	hsa-miR-3201	CLIP-seq
MIRT933775	hsa-miR-323-5p	CLIP-seq
MIRT933776	hsa-miR-3612	CLIP-seq
MIRT933777	hsa-miR-3613-3p	CLIP-seq
MIRT933778	hsa-miR-377	CLIP-seq
MIRT933779	hsa-miR-3913-3p	CLIP-seq
MIRT933780	hsa-miR-3919	CLIP-seq
MIRT933781	hsa-miR-4252	CLIP-seq
MIRT933782	hsa-miR-4265	CLIP-seq
MIRT933783	hsa-miR-4296	CLIP-seq
MIRT933784	hsa-miR-4322	CLIP-seq
MIRT933785	hsa-miR-4417	CLIP-seq
MIRT933786	hsa-miR-4419a	CLIP-seq
MIRT933787	hsa-miR-4459	CLIP-seq
MIRT933788	hsa-miR-4471	CLIP-seq
MIRT933789	hsa-miR-4483	CLIP-seq
MIRT933790	hsa-miR-4506	CLIP-seq
MIRT933791	hsa-miR-4510	CLIP-seq
MIRT933792	hsa-miR-4514	CLIP-seq
MIRT933793	hsa-miR-4533	CLIP-seq
MIRT933794	hsa-miR-4635	CLIP-seq
MIRT933795	hsa-miR-4645-5p	CLIP-seq
MIRT933796	hsa-miR-4646-5p	CLIP-seq
MIRT933797	hsa-miR-4673	CLIP-seq
MIRT933798	hsa-miR-4687-3p	CLIP-seq
MIRT933799	hsa-miR-4692	CLIP-seq
MIRT933800	hsa-miR-4695-5p	CLIP-seq
MIRT933801	hsa-miR-4696	CLIP-seq
MIRT933802	hsa-miR-4704-3p	CLIP-seq
MIRT933803	hsa-miR-4709-5p	CLIP-seq
MIRT933804	hsa-miR-4733-3p	CLIP-seq
MIRT933805	hsa-miR-4747-5p	CLIP-seq
MIRT933806	hsa-miR-4771	CLIP-seq
MIRT933807	hsa-miR-4781-3p	CLIP-seq
MIRT933808	hsa-miR-4791	CLIP-seq
MIRT933809	hsa-miR-489	CLIP-seq
MIRT933810	hsa-miR-513a-5p	CLIP-seq
MIRT933811	hsa-miR-514	CLIP-seq
MIRT933812	hsa-miR-514b-3p	CLIP-seq
MIRT933813	hsa-miR-520a-5p	CLIP-seq
MIRT933814	hsa-miR-525-5p	CLIP-seq
MIRT933815	hsa-miR-548ae	CLIP-seq
MIRT933816	hsa-miR-548aj	CLIP-seq
MIRT933817	hsa-miR-548am	CLIP-seq
MIRT933818	hsa-miR-548c-3p	CLIP-seq
MIRT933819	hsa-miR-548q	CLIP-seq
MIRT933820	hsa-miR-548x	CLIP-seq
MIRT933821	hsa-miR-550a	CLIP-seq
MIRT933822	hsa-miR-612	CLIP-seq
MIRT933823	hsa-miR-650	CLIP-seq
MIRT933824	hsa-miR-661	CLIP-seq
MIRT933825	hsa-miR-876-3p	CLIP-seq
MIRT933826	hsa-miR-921	CLIP-seq
MIRT1976477	hsa-miR-138	CLIP-seq
MIRT1976478	hsa-miR-3117-5p	CLIP-seq
MIRT1976479	hsa-miR-3663-5p	CLIP-seq
MIRT933779	hsa-miR-3913-3p	CLIP-seq
MIRT933780	hsa-miR-3919	CLIP-seq
MIRT1976480	hsa-miR-4279	CLIP-seq
MIRT1976481	hsa-miR-4318	CLIP-seq
MIRT933802	hsa-miR-4704-3p	CLIP-seq
MIRT1976482	hsa-miR-483-5p	CLIP-seq
MIRT933809	hsa-miR-489	CLIP-seq
MIRT933811	hsa-miR-514	CLIP-seq
MIRT933812	hsa-miR-514b-3p	CLIP-seq
MIRT933813	hsa-miR-520a-5p	CLIP-seq
MIRT933814	hsa-miR-525-5p	CLIP-seq
MIRT933751	hsa-miR-127-5p	CLIP-seq
MIRT2211861	hsa-miR-1913	CLIP-seq
MIRT2211862	hsa-miR-3155	CLIP-seq
MIRT2211863	hsa-miR-3155b	CLIP-seq
MIRT2211864	hsa-miR-324-3p	CLIP-seq
MIRT2211865	hsa-miR-331-3p	CLIP-seq
MIRT2211866	hsa-miR-4438	CLIP-seq
MIRT933794	hsa-miR-4635	CLIP-seq
MIRT2211867	hsa-miR-4707-5p	CLIP-seq
MIRT1976482	hsa-miR-483-5p	CLIP-seq
MIRT2211868	hsa-miR-484	CLIP-seq
MIRT2386861	hsa-miR-4794	CLIP-seq
MIRT1976482	hsa-miR-483-5p	CLIP-seq
MIRT2448184	hsa-miR-1236	CLIP-seq
MIRT2448185	hsa-miR-4753-3p	CLIP-seq
MIRT2448186	hsa-miR-4768-5p	CLIP-seq
MIRT2515617	hsa-miR-1245b-3p	CLIP-seq
MIRT933750	hsa-miR-1254	CLIP-seq
MIRT2515618	hsa-miR-1305	CLIP-seq
MIRT2515619	hsa-miR-183	CLIP-seq
MIRT2515620	hsa-miR-1972	CLIP-seq
MIRT2515621	hsa-miR-2115	CLIP-seq
MIRT2515622	hsa-miR-3065-3p	CLIP-seq
MIRT2515623	hsa-miR-3065-5p	CLIP-seq
MIRT933767	hsa-miR-3116	CLIP-seq
MIRT2515624	hsa-miR-3130-3p	CLIP-seq
MIRT2515625	hsa-miR-370	CLIP-seq
MIRT2515626	hsa-miR-378	CLIP-seq
MIRT2515627	hsa-miR-378b	CLIP-seq
MIRT2515628	hsa-miR-378c	CLIP-seq
MIRT2515629	hsa-miR-378d	CLIP-seq
MIRT2515630	hsa-miR-378e	CLIP-seq
MIRT2515631	hsa-miR-378f	CLIP-seq
MIRT2515632	hsa-miR-378h	CLIP-seq
MIRT2515633	hsa-miR-378i	CLIP-seq
MIRT2515634	hsa-miR-3942-3p	CLIP-seq
MIRT2515635	hsa-miR-3977	CLIP-seq
MIRT2515636	hsa-miR-421	CLIP-seq
MIRT2515637	hsa-miR-422a	CLIP-seq
MIRT933781	hsa-miR-4252	CLIP-seq
MIRT2515638	hsa-miR-4254	CLIP-seq
MIRT2515639	hsa-miR-4436b-5p	CLIP-seq
MIRT2515640	hsa-miR-4462	CLIP-seq
MIRT2515641	hsa-miR-4493	CLIP-seq
MIRT2515642	hsa-miR-455-3p	CLIP-seq
MIRT2515643	hsa-miR-4639-5p	CLIP-seq
MIRT2515644	hsa-miR-4650-5p	CLIP-seq
MIRT2515645	hsa-miR-4742-5p	CLIP-seq
MIRT2515646	hsa-miR-4782-5p	CLIP-seq
MIRT2515647	hsa-miR-4793-3p	CLIP-seq
MIRT933810	hsa-miR-513a-5p	CLIP-seq
MIRT2515648	hsa-miR-516a-3p	CLIP-seq
MIRT933819	hsa-miR-548q	CLIP-seq
MIRT2515649	hsa-miR-552	CLIP-seq
MIRT2515650	hsa-miR-652	CLIP-seq
MIRT2515651	hsa-miR-764	CLIP-seq
MIRT2515617	hsa-miR-1245b-3p	CLIP-seq
MIRT2515621	hsa-miR-2115	CLIP-seq
MIRT2515624	hsa-miR-3130-3p	CLIP-seq
MIRT2679245	hsa-miR-3194-5p	CLIP-seq
MIRT2515626	hsa-miR-378	CLIP-seq
MIRT2515627	hsa-miR-378b	CLIP-seq
MIRT2515628	hsa-miR-378c	CLIP-seq
MIRT2515629	hsa-miR-378d	CLIP-seq
MIRT2515630	hsa-miR-378e	CLIP-seq
MIRT2515631	hsa-miR-378f	CLIP-seq
MIRT2515632	hsa-miR-378h	CLIP-seq
MIRT2515633	hsa-miR-378i	CLIP-seq
MIRT2679246	hsa-miR-3918	CLIP-seq
MIRT2515634	hsa-miR-3942-3p	CLIP-seq
MIRT2515635	hsa-miR-3977	CLIP-seq
MIRT2515637	hsa-miR-422a	CLIP-seq
MIRT2515640	hsa-miR-4462	CLIP-seq
MIRT2515641	hsa-miR-4493	CLIP-seq
MIRT2515642	hsa-miR-455-3p	CLIP-seq
MIRT2679247	hsa-miR-4640-5p	CLIP-seq
MIRT2679248	hsa-miR-4685-5p	CLIP-seq
MIRT2679249	hsa-miR-4726-5p	CLIP-seq
MIRT933804	hsa-miR-4733-3p	CLIP-seq
MIRT2515645	hsa-miR-4742-5p	CLIP-seq
MIRT2515646	hsa-miR-4782-5p	CLIP-seq
MIRT2515647	hsa-miR-4793-3p	CLIP-seq
MIRT933810	hsa-miR-513a-5p	CLIP-seq
MIRT2515648	hsa-miR-516a-3p	CLIP-seq
MIRT933819	hsa-miR-548q	CLIP-seq
MIRT2515649	hsa-miR-552	CLIP-seq
MIRT2515650	hsa-miR-652	CLIP-seq
MIRT2515651	hsa-miR-764	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IBA
GO:0003725	Function	Double-stranded RNA binding	IDA	17704815
GO:0005515	Function	Protein binding	IPI	15574589, 19626115, 22222205, 22796965, 23602568, 23995758, 24581491, 25416956, 26321680, 26496610, 33961781, 35914814, 39251607
GO:0005634	Component	Nucleus	IDA	15574589
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006974	Process	DNA damage response	IDA	19500350
GO:0006974	Process	DNA damage response	IDA	34188037
GO:0014069	Component	Postsynaptic density	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0020037	Function	Heme binding	IDA	24449907, 24910438
GO:0020037	Function	Heme binding	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	34188037
GO:0031053	Process	Primary miRNA processing	IBA
GO:0031053	Process	Primary miRNA processing	IDA	15531877, 15574589
GO:0031053	Process	Primary miRNA processing	IDA	15574589, 24449907, 24910438
GO:0031053	Process	Primary miRNA processing	IEA
GO:0035861	Component	Site of double-strand break	IC	15574589
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	15574589, 17159994
GO:0042803	Function	Protein homodimerization activity	IDA	15574589
GO:0046872	Function	Metal ion binding	IEA
GO:0070877	Component	Microprocessor complex	IBA
GO:0070877	Component	Microprocessor complex	IDA	15574589
GO:0070877	Component	Microprocessor complex	IEA
GO:0070877	Component	Microprocessor complex	IPI	24581491
GO:0070878	Function	Primary miRNA binding	IBA
GO:0070878	Function	Primary miRNA binding	IDA	24910438
GO:0070878	Function	Primary miRNA binding	IEA
GO:0072091	Process	Regulation of stem cell proliferation	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0140517	Function	Protein-RNA adaptor activity	IDA	15574589
GO:2000633	Process	Positive regulation of pre-miRNA processing	IDA	15574589, 32926445

MIM	HGNC	e!Ensembl
609030	2847	ENSG00000128191

Q8WYQ5

Protein name

Microprocessor complex subunit DGCR8 (DiGeorge syndrome critical region 8)

Protein function

Component of the microprocessor complex that acts as a RNA- and heme-binding protein that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcrip

PDB

1X47 , 2YT4 , 3LE4 , 5B16 , 6LXD , 6LXE , 6V5B , 6V5C , 7CNC , 9ASM , 9ASN , 9ASO , 9ASP , 9ASQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00035	dsrm	512 → 576	Double-stranded RNA binding motif	Domain
PF00035	dsrm	620 → 684	Double-stranded RNA binding motif	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:12705904}.

Sequence

METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSE
LPAEDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKI
SVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESAD
KKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYE
DDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPT
EPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD
NEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGAL
GQVKAKVEVCKDESVDLEEFRSYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESER
PILPANQKLITLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSE
PFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNH
ISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKH
TVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQ
YAKKNKPNLHILSKLQEEMKRLAEEREETRKKPKMSIVASAQPGGEPLCTVDV

Sequence length

773

Interactions

View interactions

	Reactome
			MicroRNA (miRNA) biogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Autism spectrum disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DGCR8-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGEORGE SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VELOCARDIOFACIAL SYNDROME	—	ClinVar, HPO ClinVar, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WILMS TUMOR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (100)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
22q11 Deletion Syndrome	22q11 deletion syndrome	BEFREE	23055483		★★★★★ ★☆☆☆☆ Found in Text Mining only
22q11 Deletion Syndrome	22q11 deletion syndrome	Pubtator	33581109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	27519051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	27519051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31500805	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behavior Disorders	Behavior Disorders	CTD_human_DG	18469815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bilateral Wilms Tumor	Wilms tumor	CTD_human_DG	28825729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31228940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharophimosis	Blepharophimosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28739418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23629745, 26804549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22639842, 24574065, 28598829, 31858552, 32196606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	26908769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36499151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21319996, 23398123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31228940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26867589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25823356, 31841176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	26804549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	12705904, 30926277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	30926277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Microtia	Congenital microtia	Pubtator	37107637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CONOTRUNCAL ANOMALY FACE SYNDROME	Conotruncal Anomaly Face Syndrome	BEFREE	12705904		★★★★★ ★☆☆☆☆ Found in Text Mining only
CONOTRUNCAL ANOMALY FACE SYNDROME	Conotruncal Anomaly Face Syndrome	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30926277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31350386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	22694265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	31517606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	25295740	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	12705904, 15867338, 29334651, 29362439		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DiGeorge Syndrome	Digeorge syndrome	Pubtator	24018986, 26221035, 27846841, 32989314, 33638978	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DiGeorge Syndrome	Digeorge syndrome	Pubtator	25084529	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DiGeorge Syndrome	DiGeorge Syndrome	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	31805011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34257547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23663110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33758101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33758101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	36205932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	24778346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	24574065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	26804549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	26688807, 28155978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	31805011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23629745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25823356, 31841176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30964164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	22025453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31228940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25195038, 27107574, 27300436, 30877109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	24569963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	22694265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	CTD_human_DG	18469815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Disorders, Severe	Mental Disorders	CTD_human_DG	18469815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	31805011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25439752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	25439752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19347935, 24569963, 25670082, 25670083, 30341811, 31805011, 31820118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	CTD_human_DG	28825729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30367465, 31841180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	24904170		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	25823356, 31841176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31841176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoia	Paranoia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pierre Robin Syndrome	Pierre-Robin Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior embryotoxon	Posterior embryotoxon	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30964164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23135352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26206718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28342199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	24904170		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	23015298		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23015298, 23719809, 24904170		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	26173148, 26384369, 27846841, 31500805, 33581109	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwannomatosis	Schwannomatosis	BEFREE	31805011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schwannomatosis	Schwannomatosis	Pubtator	31805011, 35723634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen syndrome	Shprintzen Syndrome	BEFREE	12705904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen syndrome	Shprintzen Syndrome	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	12705904, 15867338, 29334651, 29362439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	27519051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36484990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	22179432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	30926277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	36499151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	31805011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	36499151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36499151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32196606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unilateral primary pulmonary dysgenesis	Pulmonary dysgenesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23322153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Velopharyngeal Insufficiency	Velopharyngeal Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	30926277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	25670082, 25670083, 28825729, 31805011, 31841180	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Young onset Parkinson disease	Parkinson disease	BEFREE	24018986		★★★★★ ★☆☆☆☆ Found in Text Mining only

DGCR8 (DGCR8 microprocessor complex subunit)