Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54472
Gene name	Toll interacting protein
Gene symbol	TOLLIP
Synonyms (NCBI Gene)	IL-1RAcPIP
Chromosome	11
Chromosome location	11p15.5
Summary	This gene encodes a ubiquitin-binding protein that interacts with several Toll-like receptor (TLR) signaling cascade components. The encoded protein regulates inflammatory signaling and is involved in interleukin-1 receptor trafficking and in the turnover

353

Show/Hide all (353)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020158	hsa-miR-130b-3p	Sequencing	20371350
MIRT028044	hsa-miR-93-5p	Sequencing	20371350
MIRT041248	hsa-miR-193b-3p	CLASH	23622248
MIRT439404	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT439404	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT755361	hsa-miR-6870-3p	Luciferase reporter assayWestern blotting	36184551
MIRT1446152	hsa-miR-1179	CLIP-seq
MIRT1446153	hsa-miR-1202	CLIP-seq
MIRT1446154	hsa-miR-1253	CLIP-seq
MIRT1446155	hsa-miR-1273	CLIP-seq
MIRT1446156	hsa-miR-129-5p	CLIP-seq
MIRT1446157	hsa-miR-1302	CLIP-seq
MIRT1446158	hsa-miR-1304	CLIP-seq
MIRT1446159	hsa-miR-1343	CLIP-seq
MIRT1446160	hsa-miR-139-3p	CLIP-seq
MIRT1446161	hsa-miR-144	CLIP-seq
MIRT1446162	hsa-miR-185	CLIP-seq
MIRT1446163	hsa-miR-1915	CLIP-seq
MIRT1446164	hsa-miR-2110	CLIP-seq
MIRT1446165	hsa-miR-221	CLIP-seq
MIRT1446166	hsa-miR-222	CLIP-seq
MIRT1446167	hsa-miR-2682	CLIP-seq
MIRT1446168	hsa-miR-31	CLIP-seq
MIRT1446169	hsa-miR-3122	CLIP-seq
MIRT1446170	hsa-miR-3126-5p	CLIP-seq
MIRT1446171	hsa-miR-3130-3p	CLIP-seq
MIRT1446172	hsa-miR-3147	CLIP-seq
MIRT1446173	hsa-miR-3150a-3p	CLIP-seq
MIRT1446174	hsa-miR-3175	CLIP-seq
MIRT1446175	hsa-miR-3180-5p	CLIP-seq
MIRT1446176	hsa-miR-3189-3p	CLIP-seq
MIRT1446177	hsa-miR-3194-5p	CLIP-seq
MIRT1446178	hsa-miR-3195	CLIP-seq
MIRT1446179	hsa-miR-338-3p	CLIP-seq
MIRT1446180	hsa-miR-339-3p	CLIP-seq
MIRT1446181	hsa-miR-34a	CLIP-seq
MIRT1446182	hsa-miR-34c-5p	CLIP-seq
MIRT1446183	hsa-miR-3591-3p	CLIP-seq
MIRT1446184	hsa-miR-3622b-5p	CLIP-seq
MIRT1446185	hsa-miR-3665	CLIP-seq
MIRT1446186	hsa-miR-370	CLIP-seq
MIRT1446187	hsa-miR-3907	CLIP-seq
MIRT1446188	hsa-miR-3913-5p	CLIP-seq
MIRT1446189	hsa-miR-3934	CLIP-seq
MIRT1446190	hsa-miR-3972	CLIP-seq
MIRT1446191	hsa-miR-421	CLIP-seq
MIRT1446192	hsa-miR-4257	CLIP-seq
MIRT1446193	hsa-miR-4298	CLIP-seq
MIRT1446194	hsa-miR-4304	CLIP-seq
MIRT1446195	hsa-miR-4306	CLIP-seq
MIRT1446196	hsa-miR-4310	CLIP-seq
MIRT1446197	hsa-miR-4329	CLIP-seq
MIRT1446198	hsa-miR-4419a	CLIP-seq
MIRT1446199	hsa-miR-4422	CLIP-seq
MIRT1446200	hsa-miR-4425	CLIP-seq
MIRT1446201	hsa-miR-4428	CLIP-seq
MIRT1446202	hsa-miR-4462	CLIP-seq
MIRT1446203	hsa-miR-4474-3p	CLIP-seq
MIRT1446204	hsa-miR-4488	CLIP-seq
MIRT1446205	hsa-miR-449a	CLIP-seq
MIRT1446206	hsa-miR-449b	CLIP-seq
MIRT1446207	hsa-miR-449c	CLIP-seq
MIRT1446208	hsa-miR-4510	CLIP-seq
MIRT1446209	hsa-miR-4514	CLIP-seq
MIRT1446210	hsa-miR-4527	CLIP-seq
MIRT1446211	hsa-miR-4644	CLIP-seq
MIRT1446212	hsa-miR-4645-5p	CLIP-seq
MIRT1446213	hsa-miR-4673	CLIP-seq
MIRT1446214	hsa-miR-4681	CLIP-seq
MIRT1446215	hsa-miR-4692	CLIP-seq
MIRT1446216	hsa-miR-4696	CLIP-seq
MIRT1446217	hsa-miR-4697-5p	CLIP-seq
MIRT1446218	hsa-miR-4709-5p	CLIP-seq
MIRT1446219	hsa-miR-4726-3p	CLIP-seq
MIRT1446220	hsa-miR-4738-3p	CLIP-seq
MIRT1446221	hsa-miR-4768-3p	CLIP-seq
MIRT1446222	hsa-miR-4786-5p	CLIP-seq
MIRT1446223	hsa-miR-502-5p	CLIP-seq
MIRT1446224	hsa-miR-514	CLIP-seq
MIRT1446225	hsa-miR-514b-3p	CLIP-seq
MIRT1446226	hsa-miR-520a-5p	CLIP-seq
MIRT1446227	hsa-miR-524-3p	CLIP-seq
MIRT1446228	hsa-miR-525-3p	CLIP-seq
MIRT1446229	hsa-miR-525-5p	CLIP-seq
MIRT1446230	hsa-miR-548aa	CLIP-seq
MIRT1446231	hsa-miR-548ac	CLIP-seq
MIRT1446232	hsa-miR-548d-3p	CLIP-seq
MIRT1446233	hsa-miR-548u	CLIP-seq
MIRT1446234	hsa-miR-548v	CLIP-seq
MIRT1446235	hsa-miR-548z	CLIP-seq
MIRT1446236	hsa-miR-566	CLIP-seq
MIRT1446237	hsa-miR-574-5p	CLIP-seq
MIRT1446238	hsa-miR-602	CLIP-seq
MIRT1446239	hsa-miR-644	CLIP-seq
MIRT1446240	hsa-miR-657	CLIP-seq
MIRT1446241	hsa-miR-769-5p	CLIP-seq
MIRT1446242	hsa-miR-939	CLIP-seq
MIRT1446183	hsa-miR-3591-3p	CLIP-seq
MIRT1446216	hsa-miR-4696	CLIP-seq
MIRT1557208	hsa-miR-150	CLIP-seq
MIRT2133353	hsa-miR-1205	CLIP-seq
MIRT2133354	hsa-miR-1207-5p	CLIP-seq
MIRT2133355	hsa-miR-1234	CLIP-seq
MIRT1446154	hsa-miR-1253	CLIP-seq
MIRT2133356	hsa-miR-1254	CLIP-seq
MIRT2133357	hsa-miR-1268	CLIP-seq
MIRT2133358	hsa-miR-1268b	CLIP-seq
MIRT2133359	hsa-miR-1285	CLIP-seq
MIRT2133360	hsa-miR-1296	CLIP-seq
MIRT2133361	hsa-miR-1298	CLIP-seq
MIRT1446158	hsa-miR-1304	CLIP-seq
MIRT1446159	hsa-miR-1343	CLIP-seq
MIRT2133362	hsa-miR-1909	CLIP-seq
MIRT1446163	hsa-miR-1915	CLIP-seq
MIRT2133363	hsa-miR-1972	CLIP-seq
MIRT2133364	hsa-miR-1976	CLIP-seq
MIRT2133365	hsa-miR-205	CLIP-seq
MIRT2133366	hsa-miR-2909	CLIP-seq
MIRT1446168	hsa-miR-31	CLIP-seq
MIRT2133367	hsa-miR-3116	CLIP-seq
MIRT2133368	hsa-miR-3120-3p	CLIP-seq
MIRT1446170	hsa-miR-3126-5p	CLIP-seq
MIRT2133369	hsa-miR-3155	CLIP-seq
MIRT2133370	hsa-miR-3155b	CLIP-seq
MIRT2133371	hsa-miR-3187-5p	CLIP-seq
MIRT2133372	hsa-miR-361-3p	CLIP-seq
MIRT2133373	hsa-miR-3620	CLIP-seq
MIRT2133374	hsa-miR-3662	CLIP-seq
MIRT2133375	hsa-miR-3667-5p	CLIP-seq
MIRT2133376	hsa-miR-4284	CLIP-seq
MIRT2133377	hsa-miR-4292	CLIP-seq
MIRT2133378	hsa-miR-4297	CLIP-seq
MIRT2133379	hsa-miR-4314	CLIP-seq
MIRT1446198	hsa-miR-4419a	CLIP-seq
MIRT2133380	hsa-miR-4434	CLIP-seq
MIRT2133381	hsa-miR-4436b-3p	CLIP-seq
MIRT1446203	hsa-miR-4474-3p	CLIP-seq
MIRT1446208	hsa-miR-4510	CLIP-seq
MIRT2133382	hsa-miR-4516	CLIP-seq
MIRT2133383	hsa-miR-4531	CLIP-seq
MIRT2133384	hsa-miR-4640-5p	CLIP-seq
MIRT2133385	hsa-miR-4650-5p	CLIP-seq
MIRT2133386	hsa-miR-4672	CLIP-seq
MIRT2133387	hsa-miR-4722-3p	CLIP-seq
MIRT2133388	hsa-miR-4722-5p	CLIP-seq
MIRT2133389	hsa-miR-4726-5p	CLIP-seq
MIRT2133390	hsa-miR-4727-5p	CLIP-seq
MIRT1446220	hsa-miR-4738-3p	CLIP-seq
MIRT2133391	hsa-miR-4743	CLIP-seq
MIRT2133392	hsa-miR-4755-3p	CLIP-seq
MIRT2133393	hsa-miR-4758-3p	CLIP-seq
MIRT2133394	hsa-miR-4761-3p	CLIP-seq
MIRT2133395	hsa-miR-4763-3p	CLIP-seq
MIRT1446222	hsa-miR-4786-5p	CLIP-seq
MIRT2133396	hsa-miR-483-3p	CLIP-seq
MIRT2133397	hsa-miR-484	CLIP-seq
MIRT2133398	hsa-miR-518a-3p	CLIP-seq
MIRT2133399	hsa-miR-518b	CLIP-seq
MIRT2133400	hsa-miR-518c	CLIP-seq
MIRT2133401	hsa-miR-518d-3p	CLIP-seq
MIRT2133402	hsa-miR-518f	CLIP-seq
MIRT2133403	hsa-miR-545	CLIP-seq
MIRT1446233	hsa-miR-548u	CLIP-seq
MIRT1446237	hsa-miR-574-5p	CLIP-seq
MIRT2133404	hsa-miR-612	CLIP-seq
MIRT1446239	hsa-miR-644	CLIP-seq
MIRT2133405	hsa-miR-661	CLIP-seq
MIRT2133406	hsa-miR-665	CLIP-seq
MIRT1446241	hsa-miR-769-5p	CLIP-seq
MIRT2354533	hsa-miR-101	CLIP-seq
MIRT2354534	hsa-miR-106a	CLIP-seq
MIRT2354535	hsa-miR-106b	CLIP-seq
MIRT2354536	hsa-miR-1237	CLIP-seq
MIRT2354537	hsa-miR-1248	CLIP-seq
MIRT1446154	hsa-miR-1253	CLIP-seq
MIRT2354538	hsa-miR-1273f	CLIP-seq
MIRT2354539	hsa-miR-1276	CLIP-seq
MIRT1446156	hsa-miR-129-5p	CLIP-seq
MIRT1446158	hsa-miR-1304	CLIP-seq
MIRT1446160	hsa-miR-139-3p	CLIP-seq
MIRT2354540	hsa-miR-139-5p	CLIP-seq
MIRT1446161	hsa-miR-144	CLIP-seq
MIRT2354541	hsa-miR-17	CLIP-seq
MIRT1446162	hsa-miR-185	CLIP-seq
MIRT1446163	hsa-miR-1915	CLIP-seq
MIRT2354542	hsa-miR-20a	CLIP-seq
MIRT2354543	hsa-miR-20b	CLIP-seq
MIRT2354544	hsa-miR-214	CLIP-seq
MIRT2354545	hsa-miR-24	CLIP-seq
MIRT2354546	hsa-miR-3064-5p	CLIP-seq
MIRT1446168	hsa-miR-31	CLIP-seq
MIRT1446170	hsa-miR-3126-5p	CLIP-seq
MIRT2354547	hsa-miR-3144-5p	CLIP-seq
MIRT1446175	hsa-miR-3180-5p	CLIP-seq
MIRT2354548	hsa-miR-3184	CLIP-seq
MIRT2354549	hsa-miR-3191	CLIP-seq
MIRT2354550	hsa-miR-345	CLIP-seq
MIRT1446183	hsa-miR-3591-3p	CLIP-seq
MIRT2354551	hsa-miR-3609	CLIP-seq
MIRT2354552	hsa-miR-3611	CLIP-seq
MIRT2354553	hsa-miR-3614-5p	CLIP-seq
MIRT2354554	hsa-miR-3619-5p	CLIP-seq
MIRT2133375	hsa-miR-3667-5p	CLIP-seq
MIRT2354555	hsa-miR-3689a-3p	CLIP-seq
MIRT2354556	hsa-miR-3689c	CLIP-seq
MIRT2354557	hsa-miR-3692	CLIP-seq
MIRT2354558	hsa-miR-371-5p	CLIP-seq
MIRT2354559	hsa-miR-371b-5p	CLIP-seq
MIRT2354560	hsa-miR-3914	CLIP-seq
MIRT2354561	hsa-miR-3943	CLIP-seq
MIRT2354562	hsa-miR-423-5p	CLIP-seq
MIRT2354563	hsa-miR-4256	CLIP-seq
MIRT2354564	hsa-miR-4258	CLIP-seq
MIRT2354565	hsa-miR-4283	CLIP-seq
MIRT2354566	hsa-miR-4294	CLIP-seq
MIRT1446194	hsa-miR-4304	CLIP-seq
MIRT1446195	hsa-miR-4306	CLIP-seq
MIRT2133379	hsa-miR-4314	CLIP-seq
MIRT1446198	hsa-miR-4419a	CLIP-seq
MIRT1446201	hsa-miR-4428	CLIP-seq
MIRT2354567	hsa-miR-4437	CLIP-seq
MIRT2354568	hsa-miR-4447	CLIP-seq
MIRT2354569	hsa-miR-4457	CLIP-seq
MIRT2354570	hsa-miR-4472	CLIP-seq
MIRT2354571	hsa-miR-4493	CLIP-seq
MIRT1446208	hsa-miR-4510	CLIP-seq
MIRT1446211	hsa-miR-4644	CLIP-seq
MIRT2354572	hsa-miR-4652-5p	CLIP-seq
MIRT2354573	hsa-miR-4667-5p	CLIP-seq
MIRT2354574	hsa-miR-4668-3p	CLIP-seq
MIRT2354575	hsa-miR-4671-5p	CLIP-seq
MIRT1446216	hsa-miR-4696	CLIP-seq
MIRT2354576	hsa-miR-4700-5p	CLIP-seq
MIRT2354577	hsa-miR-4711-5p	CLIP-seq
MIRT2354578	hsa-miR-4717-5p	CLIP-seq
MIRT1446219	hsa-miR-4726-3p	CLIP-seq
MIRT2133393	hsa-miR-4758-3p	CLIP-seq
MIRT2354579	hsa-miR-4762-3p	CLIP-seq
MIRT1446221	hsa-miR-4768-3p	CLIP-seq
MIRT2354580	hsa-miR-4781-5p	CLIP-seq
MIRT1446222	hsa-miR-4786-5p	CLIP-seq
MIRT2354581	hsa-miR-4796-3p	CLIP-seq
MIRT2354582	hsa-miR-486-5p	CLIP-seq
MIRT2354583	hsa-miR-513a-3p	CLIP-seq
MIRT2354584	hsa-miR-513b	CLIP-seq
MIRT2354585	hsa-miR-513c	CLIP-seq
MIRT2354586	hsa-miR-514b-5p	CLIP-seq
MIRT2354587	hsa-miR-519a	CLIP-seq
MIRT2354588	hsa-miR-519b-3p	CLIP-seq
MIRT2354589	hsa-miR-519c-3p	CLIP-seq
MIRT2354590	hsa-miR-519d	CLIP-seq
MIRT1446226	hsa-miR-520a-5p	CLIP-seq
MIRT1446229	hsa-miR-525-5p	CLIP-seq
MIRT2354591	hsa-miR-544	CLIP-seq
MIRT2133403	hsa-miR-545	CLIP-seq
MIRT2354592	hsa-miR-548ah	CLIP-seq
MIRT2354593	hsa-miR-603	CLIP-seq
MIRT2354594	hsa-miR-637	CLIP-seq
MIRT2354595	hsa-miR-761	CLIP-seq
MIRT1446241	hsa-miR-769-5p	CLIP-seq
MIRT2354596	hsa-miR-873	CLIP-seq
MIRT2354597	hsa-miR-93	CLIP-seq
MIRT1446242	hsa-miR-939	CLIP-seq
MIRT2354598	hsa-miR-943	CLIP-seq
MIRT1446154	hsa-miR-1253	CLIP-seq
MIRT2462134	hsa-miR-767-3p	CLIP-seq
MIRT2466251	hsa-miR-3911	CLIP-seq
MIRT1446189	hsa-miR-3934	CLIP-seq
MIRT2466252	hsa-miR-4773	CLIP-seq
MIRT2466253	hsa-miR-501-3p	CLIP-seq
MIRT2466254	hsa-miR-502-3p	CLIP-seq
MIRT2466255	hsa-miR-552	CLIP-seq
MIRT2462134	hsa-miR-767-3p	CLIP-seq
MIRT2648423	hsa-miR-1184	CLIP-seq
MIRT2133353	hsa-miR-1205	CLIP-seq
MIRT2354536	hsa-miR-1237	CLIP-seq
MIRT2648424	hsa-miR-1247	CLIP-seq
MIRT2354537	hsa-miR-1248	CLIP-seq
MIRT2354538	hsa-miR-1273f	CLIP-seq
MIRT2648425	hsa-miR-184	CLIP-seq
MIRT1446162	hsa-miR-185	CLIP-seq
MIRT2133362	hsa-miR-1909	CLIP-seq
MIRT1446163	hsa-miR-1915	CLIP-seq
MIRT2354544	hsa-miR-214	CLIP-seq
MIRT2648426	hsa-miR-2467-3p	CLIP-seq
MIRT2648427	hsa-miR-3138	CLIP-seq
MIRT2648428	hsa-miR-3158-5p	CLIP-seq
MIRT1446174	hsa-miR-3175	CLIP-seq
MIRT2648429	hsa-miR-3180	CLIP-seq
MIRT2648430	hsa-miR-3180-3p	CLIP-seq
MIRT2648431	hsa-miR-3196	CLIP-seq
MIRT2354554	hsa-miR-3619-5p	CLIP-seq
MIRT2133373	hsa-miR-3620	CLIP-seq
MIRT2648432	hsa-miR-3678-3p	CLIP-seq
MIRT2354555	hsa-miR-3689a-3p	CLIP-seq
MIRT2354556	hsa-miR-3689c	CLIP-seq
MIRT2648433	hsa-miR-3690	CLIP-seq
MIRT2466251	hsa-miR-3911	CLIP-seq
MIRT2354560	hsa-miR-3914	CLIP-seq
MIRT1446189	hsa-miR-3934	CLIP-seq
MIRT2354561	hsa-miR-3943	CLIP-seq
MIRT2648434	hsa-miR-4254	CLIP-seq
MIRT2648435	hsa-miR-4270	CLIP-seq
MIRT1446195	hsa-miR-4306	CLIP-seq
MIRT2648436	hsa-miR-4441	CLIP-seq
MIRT1446211	hsa-miR-4644	CLIP-seq
MIRT2648437	hsa-miR-4691-5p	CLIP-seq
MIRT2133388	hsa-miR-4722-5p	CLIP-seq
MIRT1446221	hsa-miR-4768-3p	CLIP-seq
MIRT2466252	hsa-miR-4773	CLIP-seq
MIRT1446222	hsa-miR-4786-5p	CLIP-seq
MIRT2648438	hsa-miR-4800-5p	CLIP-seq
MIRT2648439	hsa-miR-4804-5p	CLIP-seq
MIRT2466253	hsa-miR-501-3p	CLIP-seq
MIRT2466254	hsa-miR-502-3p	CLIP-seq
MIRT2354591	hsa-miR-544	CLIP-seq
MIRT2466255	hsa-miR-552	CLIP-seq
MIRT2648440	hsa-miR-564	CLIP-seq
MIRT2354595	hsa-miR-761	CLIP-seq
MIRT1446241	hsa-miR-769-5p	CLIP-seq
MIRT2354596	hsa-miR-873	CLIP-seq
MIRT1446242	hsa-miR-939	CLIP-seq
MIRT2648423	hsa-miR-1184	CLIP-seq
MIRT2133353	hsa-miR-1205	CLIP-seq
MIRT2133355	hsa-miR-1234	CLIP-seq
MIRT2648424	hsa-miR-1247	CLIP-seq
MIRT2354538	hsa-miR-1273f	CLIP-seq
MIRT2133362	hsa-miR-1909	CLIP-seq
MIRT1446163	hsa-miR-1915	CLIP-seq
MIRT2648426	hsa-miR-2467-3p	CLIP-seq
MIRT2693851	hsa-miR-3150b-3p	CLIP-seq
MIRT2648428	hsa-miR-3158-5p	CLIP-seq
MIRT1446174	hsa-miR-3175	CLIP-seq
MIRT2133373	hsa-miR-3620	CLIP-seq
MIRT2648432	hsa-miR-3678-3p	CLIP-seq
MIRT2354555	hsa-miR-3689a-3p	CLIP-seq
MIRT2354556	hsa-miR-3689c	CLIP-seq
MIRT2648433	hsa-miR-3690	CLIP-seq
MIRT2354560	hsa-miR-3914	CLIP-seq
MIRT2354561	hsa-miR-3943	CLIP-seq
MIRT2648434	hsa-miR-4254	CLIP-seq
MIRT2648435	hsa-miR-4270	CLIP-seq
MIRT2648436	hsa-miR-4441	CLIP-seq
MIRT2693852	hsa-miR-4716-3p	CLIP-seq
MIRT2133388	hsa-miR-4722-5p	CLIP-seq
MIRT2693853	hsa-miR-4723-5p	CLIP-seq
MIRT2693854	hsa-miR-4779	CLIP-seq
MIRT2693855	hsa-miR-4784	CLIP-seq
MIRT1446222	hsa-miR-4786-5p	CLIP-seq
MIRT2133406	hsa-miR-665	CLIP-seq
MIRT1446241	hsa-miR-769-5p	CLIP-seq
MIRT2354596	hsa-miR-873	CLIP-seq
MIRT1446242	hsa-miR-939	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005150	Function	Interleukin-1, type I receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	11397809, 14563850, 15047686, 16189514, 16412388, 16713569, 19060904, 19447967, 20936779, 21903422, 21988832, 25042851, 25416956, 25910212, 26320582, 31263572, 31515488, 32296183, 32814053, 33961781, 34524948, 35271311
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	11441107
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006914	Process	Autophagy	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IPI	11441107
GO:0016310	Process	Phosphorylation	IDA	1085432
GO:0016604	Component	Nuclear body	IEA
GO:0019897	Component	Extrinsic component of plasma membrane	IC	10854325
GO:0019900	Function	Kinase binding	IPI	10854325
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IBA
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032183	Function	SUMO binding	IEA
GO:0032991	Component	Protein-containing complex	IDA	10854325
GO:0032991	Component	Protein-containing complex	IEA
GO:0033235	Process	Positive regulation of protein sumoylation	IEA
GO:0035325	Function	Toll-like receptor binding	IPI	11441107
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0035580	Component	Specific granule lumen	TAS
GO:0036010	Process	Protein localization to endosome	IDA	16412388
GO:0043130	Function	Ubiquitin binding	IBA
GO:0043130	Function	Ubiquitin binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045321	Process	Leukocyte activation	NAS	11441107
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0060090	Function	Molecular adaptor activity	IDA	10854325, 27368102
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	14625308
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	10854325
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IEA

MIM	HGNC	e!Ensembl
606277	16476	ENSG00000078902

Q9H0E2

Protein name

Toll-interacting protein

Protein function

Component of the signaling pathway of IL-1 and Toll-like receptors (PubMed:10854325, PubMed:11751856). Inhibits cell activation by microbial products. Recruits IRAK1 to the IL-1 receptor complex (PubMed:10854325). Inhibits IRAK1 phosphorylation

PDB

1WGL , 2N31

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	53 → 154	C2 domain	Domain
PF02845	CUE	230 → 271	CUE domain	Domain

Sequence

MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVV
QAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMV
MPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKAIQDM
FPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP

Sequence length

274

Interactions

View interactions

	KEGG		Reactome
	Toll-like receptor signaling pathway		Neutrophil degranulation Interleukin-1 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic obstructive pulmonary disease	association; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined pulmonary fibrosis-emphysema syndrome	association; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Interstitial lung disease 2	association; Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Susceptibility to severe coronavirus disease (COVID-19)	association; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (52)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	38309995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23300433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28396568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33993221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27513438, 29393212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35172835, 36946148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28396568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33420630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17855441, 35441740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36499030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	22134550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26011492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24572204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26462859	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	29757592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	29757592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	36184551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	26462859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26462859	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	31813753	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27640899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	17362526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	23657238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28396568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25042851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24429156, 25275363, 27253772, 28648751, 29408012, 30526140		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	GWASCAT_DG	24429156		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	GWASDB_DG	24429156		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	25275363, 26331942, 28648751, 29422061, 30635297, 33639995, 34370624, 34376770, 36514019	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29422061	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32596871	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30425977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leishmaniasis Cutaneous	Leishmaniasis	Pubtator	26107286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	24294608, 26610735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	24294608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	24294608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	30635297, 34376770, 36155967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	GWASDB_DG	23583980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28860968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27640899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	28056921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	21445298, 28056921		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	26011492, 27720815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	26663441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23657238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	33993221, 35532073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	21219635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	21219635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28396568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24935372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35920704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26462859		★★★★★ ★☆☆☆☆ Found in Text Mining only

TOLLIP (toll interacting protein)