Gene Gene information from NCBI Gene database.
Entrez ID 54469
Gene name Zinc finger AN1-type containing 6
Gene symbol ZFAND6
Synonyms (NCBI Gene)
AWP1ZA20D3ZFAND5B
Chromosome 15
Chromosome location 15q25.1
miRNA miRNA information provided by mirtarbase database.
203
miRTarBase ID miRNA Experiments Reference
MIRT194174 hsa-miR-181a-5p HITS-CLIP 21572407
MIRT194176 hsa-miR-181c-5p HITS-CLIP 21572407
MIRT194177 hsa-miR-181d-5p HITS-CLIP 21572407
MIRT194180 hsa-miR-4262 HITS-CLIP 21572407
MIRT194175 hsa-miR-181b-5p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 21810480, 25416956, 30561431, 32296183, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0006625 Process Protein targeting to peroxisome IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610183 30164 ENSG00000086666
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6FIF0
Protein name AN1-type zinc finger protein 6 (Associated with PRK1 protein) (Zinc finger A20 domain-containing protein 3)
Protein function Involved in regulation of TNF-alpha induced NF-kappa-B activation and apoptosis. Involved in modulation of 'Lys-48'-linked polyubiquitination status of TRAF2 and decreases association of TRAF2 with RIPK1. Required for PTS1 target sequence-depend
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01754 zf-A20 12 35 A20-like zinc finger Family
PF01428 zf-AN1 149 186 AN1-like Zinc finger Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed with high level in heart, skeletal muscle, liver, kidney and placenta. {ECO:0000269|PubMed:11054541}.
Sequence
MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSE
SLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDV
QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHN
CSYNYK
ADAAEKIRKENPVVVGEKIQKI
Sequence length 208
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Peroxisomal protein import
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DERMATOLOGIC DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SKIN DISEASES CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arsenic Encephalopathy Arsenic Encephalopathy CTD_human_DG 16835338
★☆☆☆☆
Found in Text Mining only
Dermatologic disorders Dermatologic Disorders CTD_human_DG 16835338
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2 Diabetes mellitus, type 2 Pubtator 25273842, 26599349, 37738238 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 26599349
★☆☆☆☆
Found in Text Mining only
Hypertension Hypertension Pubtator 26599349 Associate
★☆☆☆☆
Found in Text Mining only
Metabolic Syndrome Metabolic syndrome Pubtator 26599349 Associate
★☆☆☆☆
Found in Text Mining only
Myopia Myopia Pubtator 36036911 Associate
★☆☆☆☆
Found in Text Mining only
Obesity Obesity Pubtator 36980809 Associate
★☆☆☆☆
Found in Text Mining only
Obesity Abdominal Obesity Pubtator 26599349 Associate
★☆☆☆☆
Found in Text Mining only
Schizophrenia Schizophrenia GWASCAT_DG 27846195
★★☆☆☆
Found in Text Mining + Unknown/Other Associations