GFOD1 (Gfo/Idh/MocA-like oxidoreductase domain containing 1)

Gene

• Entrez ID: 54438
• Gene name: Gfo/Idh/MocA-like oxidoreductase domain containing 1
• Gene symbol: GFOD1
• Synonyms (NCBI Gene): ADG-90, C6orf114
• Chromosome: 6
• Chromosome location: 6p24.1-p23

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020270	hsa-miR-130b-3p	Sequencing	20371350
MIRT021480	hsa-miR-9-5p	Sequencing	20371350
MIRT024809	hsa-miR-215-5p	Microarray	19074876
MIRT030005	hsa-miR-26b-5p	Sequencing	20371350
MIRT030618	hsa-miR-24-3p	Sequencing	20371350
MIRT031257	hsa-miR-19b-3p	Sequencing	20371350
MIRT048494	hsa-miR-100-5p	CLASH	23622248
MIRT042236	hsa-miR-484	CLASH	23622248
MIRT035835	hsa-miR-1276	CLASH	23622248
MIRT738508	hsa-miR-1260b	HITS-CLIP	33718276
MIRT738509	hsa-miR-1260	HITS-CLIP	33718276
MIRT738510	hsa-miR-4690-3p	HITS-CLIP	33718276
MIRT1016738	hsa-miR-132	CLIP-seq
MIRT1016739	hsa-miR-212	CLIP-seq
MIRT1016740	hsa-miR-3170	CLIP-seq
MIRT1016741	hsa-miR-3198	CLIP-seq
MIRT1016742	hsa-miR-3667-3p	CLIP-seq
MIRT1016743	hsa-miR-384	CLIP-seq
MIRT1016744	hsa-miR-4260	CLIP-seq
MIRT1016745	hsa-miR-4309	CLIP-seq
MIRT1016746	hsa-miR-4653-3p	CLIP-seq
MIRT1016747	hsa-miR-4709-5p	CLIP-seq
MIRT1016748	hsa-miR-4724-3p	CLIP-seq
MIRT1016749	hsa-miR-615-5p	CLIP-seq
MIRT1016750	hsa-miR-622	CLIP-seq
MIRT1016751	hsa-let-7a	CLIP-seq
MIRT1016752	hsa-let-7b	CLIP-seq
MIRT1016753	hsa-let-7c	CLIP-seq
MIRT1016754	hsa-let-7d	CLIP-seq
MIRT1016755	hsa-let-7e	CLIP-seq
MIRT1016756	hsa-let-7f	CLIP-seq
MIRT1016757	hsa-let-7g	CLIP-seq
MIRT1016758	hsa-let-7i	CLIP-seq
MIRT1016759	hsa-miR-103a	CLIP-seq
MIRT1016760	hsa-miR-107	CLIP-seq
MIRT1016761	hsa-miR-1202	CLIP-seq
MIRT738507	hsa-miR-1224-3p	CLIP-seq
MIRT738511	hsa-miR-1226	CLIP-seq
MIRT738513	hsa-miR-1229	CLIP-seq
MIRT1016762	hsa-miR-1243	CLIP-seq
MIRT1016763	hsa-miR-1255a	CLIP-seq
MIRT1016764	hsa-miR-1255b	CLIP-seq
MIRT1016765	hsa-miR-1269	CLIP-seq
MIRT1016766	hsa-miR-1269b	CLIP-seq
MIRT1016767	hsa-miR-1273e	CLIP-seq
MIRT1016768	hsa-miR-1275	CLIP-seq
MIRT1016769	hsa-miR-128	CLIP-seq
MIRT738506	hsa-miR-1280	CLIP-seq
MIRT1016770	hsa-miR-1288	CLIP-seq
MIRT1016771	hsa-miR-1321	CLIP-seq
MIRT1016772	hsa-miR-1343	CLIP-seq
MIRT1016773	hsa-miR-147	CLIP-seq
MIRT1016774	hsa-miR-18a	CLIP-seq
MIRT1016775	hsa-miR-18b	CLIP-seq
MIRT1016776	hsa-miR-1912	CLIP-seq
MIRT1016777	hsa-miR-1915	CLIP-seq
MIRT1016778	hsa-miR-1976	CLIP-seq
MIRT1016779	hsa-miR-19a	CLIP-seq
MIRT1016780	hsa-miR-19b	CLIP-seq
MIRT1016781	hsa-miR-202	CLIP-seq
MIRT1016782	hsa-miR-214	CLIP-seq
MIRT1016783	hsa-miR-2355-5p	CLIP-seq
MIRT1016784	hsa-miR-27a	CLIP-seq
MIRT1016785	hsa-miR-27b	CLIP-seq
MIRT1016786	hsa-miR-2861	CLIP-seq
MIRT1016787	hsa-miR-298	CLIP-seq
MIRT1016788	hsa-miR-3130-5p	CLIP-seq
MIRT1016789	hsa-miR-3134	CLIP-seq
MIRT1016790	hsa-miR-3158-5p	CLIP-seq
MIRT1016791	hsa-miR-3162-5p	CLIP-seq
MIRT1016792	hsa-miR-3194-5p	CLIP-seq
MIRT1016793	hsa-miR-331-3p	CLIP-seq
MIRT1016794	hsa-miR-3545-3p	CLIP-seq
MIRT1016795	hsa-miR-3619-5p	CLIP-seq
MIRT1016796	hsa-miR-3647-3p	CLIP-seq
MIRT1016797	hsa-miR-3650	CLIP-seq
MIRT1016798	hsa-miR-3654	CLIP-seq
MIRT1016799	hsa-miR-3690	CLIP-seq
MIRT1016800	hsa-miR-3911	CLIP-seq
MIRT1016801	hsa-miR-3972	CLIP-seq
MIRT1016802	hsa-miR-4254	CLIP-seq
MIRT1016803	hsa-miR-4255	CLIP-seq
MIRT1016744	hsa-miR-4260	CLIP-seq
MIRT1016804	hsa-miR-4279	CLIP-seq
MIRT1016805	hsa-miR-4436b-3p	CLIP-seq
MIRT1016806	hsa-miR-4458	CLIP-seq
MIRT1016807	hsa-miR-4482	CLIP-seq
MIRT1016808	hsa-miR-4488	CLIP-seq
MIRT1016809	hsa-miR-4493	CLIP-seq
MIRT1016810	hsa-miR-4500	CLIP-seq
MIRT1016811	hsa-miR-4515	CLIP-seq
MIRT1016812	hsa-miR-4519	CLIP-seq
MIRT1016813	hsa-miR-4530	CLIP-seq
MIRT1016814	hsa-miR-4532	CLIP-seq
MIRT1016815	hsa-miR-4639-3p	CLIP-seq
MIRT1016816	hsa-miR-4648	CLIP-seq
MIRT1016817	hsa-miR-4654	CLIP-seq
MIRT1016818	hsa-miR-4665-5p	CLIP-seq
MIRT1016819	hsa-miR-4667-3p	CLIP-seq
MIRT1016820	hsa-miR-4697-5p	CLIP-seq
MIRT1016821	hsa-miR-4722-3p	CLIP-seq
MIRT1016822	hsa-miR-4726-3p	CLIP-seq
MIRT1016823	hsa-miR-4728-5p	CLIP-seq
MIRT738512	hsa-miR-4733-3p	CLIP-seq
MIRT1016824	hsa-miR-4735-3p	CLIP-seq
MIRT1016825	hsa-miR-4739	CLIP-seq
MIRT1016826	hsa-miR-4740-5p	CLIP-seq
MIRT1016827	hsa-miR-4753-5p	CLIP-seq
MIRT1016828	hsa-miR-4756-5p	CLIP-seq
MIRT1016829	hsa-miR-4761-5p	CLIP-seq
MIRT1016830	hsa-miR-4769-5p	CLIP-seq
MIRT1016831	hsa-miR-486-3p	CLIP-seq
MIRT1016832	hsa-miR-502-5p	CLIP-seq
MIRT1016833	hsa-miR-513c	CLIP-seq
MIRT1016834	hsa-miR-514b-5p	CLIP-seq
MIRT1016835	hsa-miR-517a	CLIP-seq
MIRT1016836	hsa-miR-517b	CLIP-seq
MIRT1016837	hsa-miR-517c	CLIP-seq
MIRT1016838	hsa-miR-644	CLIP-seq
MIRT1016839	hsa-miR-761	CLIP-seq
MIRT1016840	hsa-miR-875-3p	CLIP-seq
MIRT1016841	hsa-miR-9	CLIP-seq
MIRT1016842	hsa-miR-98	CLIP-seq
MIRT1016843	hsa-miR-139-3p	CLIP-seq
MIRT1016844	hsa-miR-3187-3p	CLIP-seq
MIRT1016845	hsa-miR-3689d	CLIP-seq
MIRT1016846	hsa-miR-4435	CLIP-seq
MIRT1016847	hsa-miR-4443	CLIP-seq
MIRT1016848	hsa-miR-4529-5p	CLIP-seq
MIRT1016849	hsa-miR-4701-5p	CLIP-seq
MIRT1016850	hsa-miR-548s	CLIP-seq
MIRT1016851	hsa-miR-588	CLIP-seq
MIRT1920458	hsa-miR-3614-3p	CLIP-seq
MIRT1920459	hsa-miR-4307	CLIP-seq
MIRT1920458	hsa-miR-3614-3p	CLIP-seq
MIRT1920459	hsa-miR-4307	CLIP-seq
MIRT1920458	hsa-miR-3614-3p	CLIP-seq
MIRT1920459	hsa-miR-4307	CLIP-seq
MIRT1921626	hsa-miR-129-5p	CLIP-seq
MIRT1921626	hsa-miR-129-5p	CLIP-seq
MIRT1921626	hsa-miR-129-5p	CLIP-seq
MIRT1922040	hsa-miR-501-5p	CLIP-seq
MIRT1921626	hsa-miR-129-5p	CLIP-seq
MIRT1922743	hsa-miR-500a	CLIP-seq
MIRT1922040	hsa-miR-501-5p	CLIP-seq
MIRT1016778	hsa-miR-1976	CLIP-seq
MIRT2000942	hsa-miR-1289	CLIP-seq
MIRT2000943	hsa-miR-2116	CLIP-seq
MIRT1016741	hsa-miR-3198	CLIP-seq
MIRT2000944	hsa-miR-4294	CLIP-seq
MIRT1016745	hsa-miR-4309	CLIP-seq
MIRT2000945	hsa-miR-4662a-5p	CLIP-seq
MIRT2234382	hsa-miR-1827	CLIP-seq
MIRT1921626	hsa-miR-129-5p	CLIP-seq
MIRT1922743	hsa-miR-500a	CLIP-seq
MIRT1922040	hsa-miR-501-5p	CLIP-seq
MIRT1921626	hsa-miR-129-5p	CLIP-seq
MIRT2442188	hsa-miR-4521	CLIP-seq
MIRT2442189	hsa-miR-4668-3p	CLIP-seq
MIRT1922743	hsa-miR-500a	CLIP-seq
MIRT1922040	hsa-miR-501-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183, 32814053, 38946427
GO:0005576	Component	Extracellular region	IEA
GO:0042802	Function	Identical protein binding	IDA	38946427

Other IDs

• MIM: 619932
• HGNC: 21096
• e!Ensembl: ENSG00000145990

Protein

• UniProt ID: Q9NXC2
• Protein name: Glucose-fructose oxidoreductase domain-containing protein 1 (Gfo/Idh/MocA-like oxidoreductase domain-containing protein 1)
• Protein function: Probably catalytically inactive enzyme. Does not bind NAD or NADP.
• PDB: 8Y7P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01408	GFO_IDH_MocA	4 → 118	Oxidoreductase family, NAD-binding Rossmann fold	Family
  PF02894	GFO_IDH_MocA_C	132 → 362	Oxidoreductase family, C-terminal alpha/beta domain	Domain

• Sequence:

  MLPGVGVFGTSLTARVIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLL
  HQDVDLVCINLPPPLTRQIAVKTLGIGKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGN
  VLRFLPAFVRMKQLIEEGYVGEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHSVGTYI
  IDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFN
  VPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQDATPVSNSLLPEKAFSDIPS
  PYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQ
  NIAIMTEEPELSPAYLISEAMRRSRMSLYC

• Sequence length: 390

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27191742	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27191742		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36194351	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	30683112	Associate	★☆☆☆☆ Found in Text Mining only