Gene Gene information from NCBI Gene database.
Entrez ID 5443
Gene name Proopiomelanocortin
Gene symbol POMC
Synonyms (NCBI Gene)
ACTHCLIPLPHMSHNPPOBAIRHPOC
Chromosome 2
Chromosome location 2p23.3
Summary This gene encodes a preproprotein that undergoes extensive, tissue-specific, post-translational processing via cleavage by subtilisin-like enzymes known as prohormone convertases. There are eight potential cleavage sites within the preproprotein and, depe
SNPs SNP information provided by dbSNP.
13
SNP ID Visualize variation Clinical significance Consequence
rs28932472 G>C Risk-factor, benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs121918111 C>A,G,T Pathogenic Stop gained, coding sequence variant, missense variant
rs121918112 T>A Pathogenic Stop gained, coding sequence variant
rs746815510 ->CACCCGAGGGGCCCCCGAGGGCCCC Pathogenic Coding sequence variant, frameshift variant
rs753856820 G>T Pathogenic 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
5
miRTarBase ID miRNA Experiments Reference
MIRT005899 hsa-miR-488-3p Luciferase reporter assayMicroarray 21168126
MIRT017417 hsa-miR-335-5p Microarray 18185580
MIRT735745 hsa-miR-383-3p Luciferase reporter assayqRT-PCR 31847355
MIRT735746 hsa-miR-384 Luciferase reporter assayqRT-PCR 31847355
MIRT005899 hsa-miR-488-3p Luciferase reporter assayqRT-PCR 31847355
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
49
GO ID Ontology Definition Evidence Reference
GO:0001664 Function G protein-coupled receptor binding IBA
GO:0001664 Function G protein-coupled receptor binding IDA 19452503
GO:0005102 Function Signaling receptor binding IMP 9620771
GO:0005179 Function Hormone activity IEA
GO:0005179 Function Hormone activity IMP 9620771
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
176830 9201 ENSG00000115138
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01189
Protein name Pro-opiomelanocortin (POMC) (Corticotropin-lipotropin) [Cleaved into: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide; Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanocyte-stimulating hormone alpha (Alpha-MSH) (Melanotropin alpha); Cortic
Protein function [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocy
PDB 4XNH , 4XPD , 4Y49 , 6TUB , 7F53 , 7F54 , 7PIV , 8F7Q , 8INR , 8IOC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08384 NPP 27 70 Pro-opiomelanocortin, N-terminal region Family
PF00976 ACTH_domain 74 91 Corticotropin ACTH domain Family
PF00976 ACTH_domain 136 155 Corticotropin ACTH domain Family
PF00976 ACTH_domain 218 236 Corticotropin ACTH domain Family
PF08035 Op_neuropeptide 237 264 Opioids neuropeptide Family
Tissue specificity TISSUE SPECIFICITY: ACTH and MSH are produced by the pituitary gland.
Sequence
MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPM
FPGNGDEQPL
TENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGG
PEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKREL
TGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGF
MTSEKSQTPLVTLFKNAIIKNAYK
KGE
Sequence length 267
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Estrogen signaling pathway
Melanogenesis
Adipocytokine signaling pathway
Aldosterone synthesis and secretion
Cortisol synthesis and secretion
Cushing syndrome
  Opioid Signalling
Androgen biosynthesis
Glucocorticoid biosynthesis
G-protein activation
Peptide hormone biosynthesis
Endogenous sterols
Peptide ligand-binding receptors
G alpha (s) signalling events
G alpha (i) signalling events
Defective ACTH causes Obesity and Pro-opiomelanocortinin deficiency (POMCD)
Interleukin-4 and Interleukin-13 signaling
ADORA2B mediated anti-inflammatory cytokines production
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
99
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Obesity Likely pathogenic; Pathogenic rs2149220092, rs753856820 RCV001823844
RCV002482865
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Obesity due to pro-opiomelanocortin deficiency Pathogenic rs2465563629, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs1553400259, rs1573250294, rs1573254045 RCV002285116
RCV000014281
RCV000014282
RCV000014283
RCV000014285
View all (4 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
POMC-related disorder Pathogenic rs746815510, rs781244602 RCV004533292
RCV004735782
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AMNESIA CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AMNESTIC DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AORTIC STENOSIS, SUBVALVULAR CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ARTHRITIS, GOUTY CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
11-Beta-hydroxylase deficiency 11-beta-hydroxylase deficiency BEFREE 6244328
★☆☆☆☆
Found in Text Mining only
3 beta-Hydroxysteroid dehydrogenase deficiency 3 beta-hydroxysteroid dehydrogenase deficiency BEFREE 11344940, 12050224, 3029158, 7651769, 8077318, 8923844
★☆☆☆☆
Found in Text Mining only
46, XY Disorders of Sex Development 46, XY disorder of sex development BEFREE 24405868
★☆☆☆☆
Found in Text Mining only
Aarskog syndrome Aarskog Syndrome BEFREE 11592568, 12110946, 15673970, 17161331, 18059087, 18492762, 19423561, 19558534, 19773404, 19795005, 21274326, 21701219, 23279877, 23708259, 24224542
View all (6 more)
★☆☆☆☆
Found in Text Mining only
Acanthosis Nigricans Acanthosis Nigricans HPO_DG
★☆☆☆☆
Found in Text Mining only
Acromegaly Acromegaly Pubtator 28865461 Associate
★☆☆☆☆
Found in Text Mining only
Acromegaly Acromegaly BEFREE 31505284, 31801917
★☆☆☆☆
Found in Text Mining only
ACTH Deficiency, Isolated ACTH Deficiency BEFREE 22170728, 23649472, 31513261
★☆☆☆☆
Found in Text Mining only
ACTH Syndrome, Ectopic Ectopic ACTH secretion syndrome BEFREE 11075732, 11932296, 15239795, 15845926, 16382005, 18075284, 20015838, 2536890, 26643914, 2845257, 29587720, 30232300, 30392451, 30918166, 8396510
View all (3 more)
★☆☆☆☆
Found in Text Mining only
ACTH Syndrome, Ectopic Ectopic ACTH secretion syndrome CTD_human_DG 1459535, 2844640, 4367732, 8562174
★☆☆☆☆
Found in Text Mining only