Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5440
Gene name	RNA polymerase II, I and III subunit K
Gene symbol	POLR2K
Synonyms (NCBI Gene)	ABC10-alphaRPABC4RPB10alphaRPB12RPB7.0hRPB7.0hsRPB10a
Chromosome	8
Chromosome location	8q22.2
Summary	This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. [provided by RefSeq, Jul 2008]

111

Show/Hide all (111)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002738	hsa-miR-1-3p	Microarray	15685193
MIRT002738	hsa-miR-1-3p	Microarray;Other	15685193
MIRT439931	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439931	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT1249041	hsa-miR-101	CLIP-seq
MIRT1249042	hsa-miR-1284	CLIP-seq
MIRT1249043	hsa-miR-142-5p	CLIP-seq
MIRT1249044	hsa-miR-144	CLIP-seq
MIRT1249045	hsa-miR-216a	CLIP-seq
MIRT1249046	hsa-miR-216b	CLIP-seq
MIRT1249047	hsa-miR-300	CLIP-seq
MIRT1249048	hsa-miR-302f	CLIP-seq
MIRT1249049	hsa-miR-3148	CLIP-seq
MIRT1249050	hsa-miR-323-3p	CLIP-seq
MIRT1249051	hsa-miR-331-5p	CLIP-seq
MIRT1249052	hsa-miR-340	CLIP-seq
MIRT1249053	hsa-miR-3613-3p	CLIP-seq
MIRT1249054	hsa-miR-3688-3p	CLIP-seq
MIRT1249055	hsa-miR-3691-3p	CLIP-seq
MIRT1249056	hsa-miR-381	CLIP-seq
MIRT1249057	hsa-miR-3924	CLIP-seq
MIRT1249058	hsa-miR-411	CLIP-seq
MIRT1249059	hsa-miR-4257	CLIP-seq
MIRT1249060	hsa-miR-4477a	CLIP-seq
MIRT1249061	hsa-miR-450b-5p	CLIP-seq
MIRT1249062	hsa-miR-4528	CLIP-seq
MIRT1249063	hsa-miR-4666-3p	CLIP-seq
MIRT1249064	hsa-miR-4678	CLIP-seq
MIRT1249065	hsa-miR-4720-3p	CLIP-seq
MIRT1249066	hsa-miR-4747-5p	CLIP-seq
MIRT1249067	hsa-miR-4775	CLIP-seq
MIRT1249068	hsa-miR-4777-5p	CLIP-seq
MIRT1249069	hsa-miR-4789-5p	CLIP-seq
MIRT1249070	hsa-miR-4795-3p	CLIP-seq
MIRT1249071	hsa-miR-4804-3p	CLIP-seq
MIRT1249072	hsa-miR-487a	CLIP-seq
MIRT1249073	hsa-miR-513a-3p	CLIP-seq
MIRT1249074	hsa-miR-518d-5p	CLIP-seq
MIRT1249075	hsa-miR-519b-5p	CLIP-seq
MIRT1249076	hsa-miR-519c-5p	CLIP-seq
MIRT1249077	hsa-miR-520c-5p	CLIP-seq
MIRT1249078	hsa-miR-526a	CLIP-seq
MIRT1249079	hsa-miR-548p	CLIP-seq
MIRT1249080	hsa-miR-568	CLIP-seq
MIRT1249081	hsa-miR-630	CLIP-seq
MIRT2073531	hsa-miR-1	CLIP-seq
MIRT2073532	hsa-miR-1183	CLIP-seq
MIRT2073533	hsa-miR-206	CLIP-seq
MIRT1249045	hsa-miR-216a	CLIP-seq
MIRT1249046	hsa-miR-216b	CLIP-seq
MIRT1249047	hsa-miR-300	CLIP-seq
MIRT1249048	hsa-miR-302f	CLIP-seq
MIRT1249053	hsa-miR-3613-3p	CLIP-seq
MIRT2073534	hsa-miR-3673	CLIP-seq
MIRT1249055	hsa-miR-3691-3p	CLIP-seq
MIRT1249056	hsa-miR-381	CLIP-seq
MIRT2073535	hsa-miR-3936	CLIP-seq
MIRT2073536	hsa-miR-4471	CLIP-seq
MIRT1249063	hsa-miR-4666-3p	CLIP-seq
MIRT2073537	hsa-miR-4671-5p	CLIP-seq
MIRT2073538	hsa-miR-4716-3p	CLIP-seq
MIRT1249065	hsa-miR-4720-3p	CLIP-seq
MIRT1249066	hsa-miR-4747-5p	CLIP-seq
MIRT1249067	hsa-miR-4775	CLIP-seq
MIRT1249069	hsa-miR-4789-5p	CLIP-seq
MIRT2073539	hsa-miR-4799-5p	CLIP-seq
MIRT1249071	hsa-miR-4804-3p	CLIP-seq
MIRT1249079	hsa-miR-548p	CLIP-seq
MIRT2073540	hsa-miR-606	CLIP-seq
MIRT2073541	hsa-miR-613	CLIP-seq
MIRT2073542	hsa-miR-625	CLIP-seq
MIRT2073531	hsa-miR-1	CLIP-seq
MIRT2073532	hsa-miR-1183	CLIP-seq
MIRT2300518	hsa-miR-1245b-3p	CLIP-seq
MIRT2300519	hsa-miR-1278	CLIP-seq
MIRT1249042	hsa-miR-1284	CLIP-seq
MIRT2300520	hsa-miR-1911	CLIP-seq
MIRT2300521	hsa-miR-2052	CLIP-seq
MIRT2073533	hsa-miR-206	CLIP-seq
MIRT1249047	hsa-miR-300	CLIP-seq
MIRT2073534	hsa-miR-3673	CLIP-seq
MIRT1249055	hsa-miR-3691-3p	CLIP-seq
MIRT1249056	hsa-miR-381	CLIP-seq
MIRT2073535	hsa-miR-3936	CLIP-seq
MIRT2300522	hsa-miR-4420	CLIP-seq
MIRT2300523	hsa-miR-4464	CLIP-seq
MIRT2073536	hsa-miR-4471	CLIP-seq
MIRT2300524	hsa-miR-4488	CLIP-seq
MIRT2300525	hsa-miR-451b	CLIP-seq
MIRT1249063	hsa-miR-4666-3p	CLIP-seq
MIRT2073537	hsa-miR-4671-5p	CLIP-seq
MIRT2300526	hsa-miR-4697-5p	CLIP-seq
MIRT2073538	hsa-miR-4716-3p	CLIP-seq
MIRT1249066	hsa-miR-4747-5p	CLIP-seq
MIRT2300527	hsa-miR-4748	CLIP-seq
MIRT2073539	hsa-miR-4799-5p	CLIP-seq
MIRT2073540	hsa-miR-606	CLIP-seq
MIRT2073541	hsa-miR-613	CLIP-seq
MIRT2073542	hsa-miR-625	CLIP-seq
MIRT2300528	hsa-miR-637	CLIP-seq
MIRT2073531	hsa-miR-1	CLIP-seq
MIRT2073533	hsa-miR-206	CLIP-seq
MIRT2073534	hsa-miR-3673	CLIP-seq
MIRT2300522	hsa-miR-4420	CLIP-seq
MIRT2392833	hsa-miR-4433	CLIP-seq
MIRT2392834	hsa-miR-4459	CLIP-seq
MIRT2300524	hsa-miR-4488	CLIP-seq
MIRT2300526	hsa-miR-4697-5p	CLIP-seq
MIRT2392835	hsa-miR-4768-3p	CLIP-seq
MIRT2073541	hsa-miR-613	CLIP-seq
MIRT2300528	hsa-miR-637	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000428	Component	DNA-directed RNA polymerase complex	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	IBA
GO:0003899	Function	DNA-directed RNA polymerase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	9852112
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005665	Component	RNA polymerase II, core complex	IBA
GO:0005665	Component	RNA polymerase II, core complex	IDA	9852112
GO:0005666	Component	RNA polymerase III complex	IBA
GO:0005666	Component	RNA polymerase III complex	IDA	33335104, 34675218
GO:0005730	Component	Nucleolus	IEA
GO:0005736	Component	RNA polymerase I complex	IBA
GO:0005736	Component	RNA polymerase I complex	IDA	34671025, 36271492
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006356	Process	Regulation of transcription by RNA polymerase I	TAS	7651387
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006366	Process	Transcription by RNA polymerase II	TAS	7651387
GO:0006383	Process	Transcription by RNA polymerase III	TAS	7651387
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	7651387
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
606033	9198	ENSG00000147669

P53803

Protein name

DNA-directed RNA polymerases I, II, and III subunit RPABC4 (RNA polymerases I, II, and III subunit ABC4) (ABC10-alpha) (DNA-directed RNA polymerase II subunit K) (RNA polymerase II 7.0 kDa subunit) (RPB7.0) (RPB10alpha)

Protein function

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and

PDB

5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 6DRD , 6O9L , 6XRE , 7A6H , 7AE1 , 7AE3 , 7AEA , 7AST , 7D58 , 7D59 , 7DN3 , 7DU2 , 7FJI , 7FJJ , 7LBM , 7OB9 , 7OBA , 7OBB , 7VBA , 7VBB , 7VBC , 8A43 , 8ITY , 8IUE , 8IUH , 9EHZ , 9EI1 , 9EI3 , 9EI4 , 9FSO , 9FSP , 9FSQ , 9FSR , 9FSS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03604	DNA_RNApol_7kD	17 → 48	DNA directed RNA polymerase, 7 kDa subunit	Domain

Sequence

MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Sequence length

Interactions

View interactions

	KEGG		Reactome
	RNA polymerase Nucleotide excision repair Cytosolic DNA-sensing pathway Huntington disease		Formation of RNA Pol II elongation complex Formation of the Early Elongation Complex Formation of HIV-1 elongation complex containing HIV-1 Tat Viral Messenger RNA Synthesis Cytosolic sensors of pathogen-associated DNA MicroRNA (miRNA) biogenesis B-WICH complex positively regulates rRNA expression Transcriptional regulation by small RNAs RNA Polymerase II Pre-transcription Events Formation of TC-NER Pre-Incision Complex Transcription-Coupled Nucleotide Excision Repair (TC-NER) Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER TP53 Regulates Transcription of DNA Repair Genes FGFR2 alternative splicing RNA polymerase II transcribes snRNA genes mRNA Capping mRNA Splicing - Major Pathway mRNA Splicing - Minor Pathway Processing of Capped Intron-Containing Pre-mRNA RNA Polymerase I Transcription Initiation RNA Polymerase I Promoter Escape RNA Polymerase II Promoter Escape RNA Polymerase II Transcription Pre-Initiation And Promoter Opening RNA Polymerase I Transcription Termination RNA Polymerase II Transcription Initiation RNA Polymerase II Transcription Elongation RNA Polymerase II Transcription Initiation And Promoter Clearance RNA Polymerase III Transcription Initiation From Type 1 Promoter RNA Polymerase III Transcription Initiation From Type 2 Promoter RNA Polymerase III Transcription Initiation From Type 3 Promoter RNA Pol II CTD phosphorylation and interaction with CE Estrogen-dependent gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INTERSTITIAL LUNG DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	32444848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17786358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33622336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

POLR2K (RNA polymerase II, I and III subunit K)