TREM1 (triggering receptor expressed on myeloid cells 1)

Gene

• Entrez ID: 54210
• Gene name: Triggering receptor expressed on myeloid cells 1
• Gene symbol: TREM1
• Synonyms (NCBI Gene): CD354, TREM-1
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: This gene encodes a receptor belonging to the Ig superfamily that is expressed on myeloid cells. This protein amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-infl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT650352	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT650351	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT650350	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT650349	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT650348	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT650347	hsa-miR-3192-5p	HITS-CLIP	23824327
MIRT650346	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT650345	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT650344	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT650343	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT650342	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT650341	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT650340	hsa-miR-421	HITS-CLIP	23824327
MIRT650339	hsa-miR-4314	HITS-CLIP	23824327
MIRT650338	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT739223	hsa-miR-3673	HITS-CLIP	33718276
MIRT739224	hsa-miR-1	HITS-CLIP	33718276
MIRT739230	hsa-miR-4430	HITS-CLIP	33718276
MIRT650352	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT650351	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT650350	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT650349	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT650348	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT650347	hsa-miR-3192-5p	HITS-CLIP	23824327
MIRT650346	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT650345	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT650344	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT650343	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT650342	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT650341	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT650340	hsa-miR-421	HITS-CLIP	23824327
MIRT650339	hsa-miR-4314	HITS-CLIP	23824327
MIRT650338	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT756267	hsa-miR-150-5p	Luciferase reporter assay, Western blotting, qRT-PCR	37326693
MIRT739221	hsa-miR-1252	CLIP-seq
MIRT1452400	hsa-miR-1253	CLIP-seq
MIRT739228	hsa-miR-138	CLIP-seq
MIRT739225	hsa-miR-206	CLIP-seq
MIRT1452401	hsa-miR-3120-5p	CLIP-seq
MIRT1452402	hsa-miR-3160-3p	CLIP-seq
MIRT739226	hsa-miR-3165	CLIP-seq
MIRT739231	hsa-miR-3652	CLIP-seq
MIRT1452403	hsa-miR-3921	CLIP-seq
MIRT1452404	hsa-miR-4251	CLIP-seq
MIRT1452405	hsa-miR-4325	CLIP-seq
MIRT1452406	hsa-miR-4329	CLIP-seq
MIRT739227	hsa-miR-4456	CLIP-seq
MIRT1452407	hsa-miR-4487	CLIP-seq
MIRT739229	hsa-miR-4505	CLIP-seq
MIRT1452408	hsa-miR-4653-5p	CLIP-seq
MIRT1452409	hsa-miR-4742-3p	CLIP-seq
MIRT1452410	hsa-miR-4768-5p	CLIP-seq
MIRT1452411	hsa-miR-558	CLIP-seq
MIRT739222	hsa-miR-613	CLIP-seq
MIRT1452412	hsa-miR-626	CLIP-seq
MIRT739221	hsa-miR-1252	CLIP-seq
MIRT739228	hsa-miR-138	CLIP-seq
MIRT739225	hsa-miR-206	CLIP-seq
MIRT739226	hsa-miR-3165	CLIP-seq
MIRT739231	hsa-miR-3652	CLIP-seq
MIRT739227	hsa-miR-4456	CLIP-seq
MIRT739229	hsa-miR-4505	CLIP-seq
MIRT739222	hsa-miR-613	CLIP-seq
MIRT2135446	hsa-miR-1237	CLIP-seq
MIRT2135447	hsa-miR-1248	CLIP-seq
MIRT2135448	hsa-miR-1260	CLIP-seq
MIRT2135449	hsa-miR-1260b	CLIP-seq
MIRT2135450	hsa-miR-1276	CLIP-seq
MIRT2135451	hsa-miR-188-3p	CLIP-seq
MIRT2135452	hsa-miR-3138	CLIP-seq
MIRT2135453	hsa-miR-3156-3p	CLIP-seq
MIRT2135454	hsa-miR-3160-5p	CLIP-seq
MIRT2135455	hsa-miR-331-3p	CLIP-seq
MIRT2135456	hsa-miR-3607-3p	CLIP-seq
MIRT2135457	hsa-miR-3690	CLIP-seq
MIRT2135458	hsa-miR-4267	CLIP-seq
MIRT2135459	hsa-miR-4301	CLIP-seq
MIRT2135460	hsa-miR-4308	CLIP-seq
MIRT2135461	hsa-miR-4311	CLIP-seq
MIRT2135462	hsa-miR-4638-3p	CLIP-seq
MIRT2135463	hsa-miR-4693-3p	CLIP-seq
MIRT2135464	hsa-miR-4778-3p	CLIP-seq
MIRT2135465	hsa-miR-520f	CLIP-seq
MIRT2135466	hsa-miR-583	CLIP-seq
MIRT2135446	hsa-miR-1237	CLIP-seq
MIRT2135447	hsa-miR-1248	CLIP-seq
MIRT2356588	hsa-miR-2110	CLIP-seq
MIRT2356589	hsa-miR-3150a-3p	CLIP-seq
MIRT2135455	hsa-miR-331-3p	CLIP-seq
MIRT2135457	hsa-miR-3690	CLIP-seq
MIRT2356590	hsa-miR-4271	CLIP-seq
MIRT2135460	hsa-miR-4308	CLIP-seq
MIRT2135462	hsa-miR-4638-3p	CLIP-seq
MIRT2356591	hsa-miR-4725-3p	CLIP-seq
MIRT2135464	hsa-miR-4778-3p	CLIP-seq
MIRT2396329	hsa-miR-4685-5p	CLIP-seq
MIRT2462290	hsa-miR-1323	CLIP-seq
MIRT2462291	hsa-miR-4434	CLIP-seq
MIRT2462292	hsa-miR-4468	CLIP-seq
MIRT2462293	hsa-miR-4516	CLIP-seq
MIRT2462294	hsa-miR-4722-5p	CLIP-seq
MIRT2462295	hsa-miR-4768-3p	CLIP-seq
MIRT2462296	hsa-miR-548a-3p	CLIP-seq
MIRT2462297	hsa-miR-548e	CLIP-seq
MIRT2462298	hsa-miR-548f	CLIP-seq
MIRT2462299	hsa-miR-548o	CLIP-seq
MIRT1452401	hsa-miR-3120-5p	CLIP-seq
MIRT1452402	hsa-miR-3160-3p	CLIP-seq
MIRT1452407	hsa-miR-4487	CLIP-seq
MIRT1452409	hsa-miR-4742-3p	CLIP-seq
MIRT1452411	hsa-miR-558	CLIP-seq
MIRT1452412	hsa-miR-626	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	17098818
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	26561551
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0006959	Process	Humoral immune response	TAS	10799849
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	17098818
GO:0016020	Component	Membrane	IEA
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0035556	Process	Intracellular signal transduction	TAS	10799849
GO:0038023	Function	Signaling receptor activity	TAS	10799849
GO:0045087	Process	Innate immune response	IEA
GO:0070945	Process	Neutrophil-mediated killing of gram-negative bacterium	IBA
GO:0097110	Function	Scaffold protein binding	IPI	11602640
GO:0140319	Function	Receptor decoy activity	IDA	26561551

Other IDs

• MIM: 605085
• HGNC: 17760
• e!Ensembl: ENSG00000124731

Protein

• UniProt ID: Q9NP99
• Protein name: Triggering receptor expressed on myeloid cells 1 (TREM-1) (Triggering receptor expressed on monocytes 1) (CD antigen CD354)
• Protein function: [Isoform 1]: Cell surface receptor that plays important roles in innate and adaptive immunity by amplifying inflammatory responses (PubMed:10799849, PubMed:21393102). Upon activation by various ligands such as PGLYRP1, HMGB1 or HSP70, multimeriz
• PDB: 1Q8M, 1SMO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	25 → 134	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mostly expressed by immune cells of the myeloid lineage, such as monocytes, macrophages, neutrophils and dendritic cells (PubMed:10799849). Expression is associated with a mature stage of myeloid development (PubMed:11922939). Highly e
• Sequence:

  MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRD
  GEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPK
  EPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKST
  ADVSTPDSEINLTNVTDIIRVPVFNIVILLAGGFLSKSLVFSVLFAVTLRSFVP

• Sequence length: 234

Pathways

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Cell surface interactions at the vascular wall
DAP12 interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	15309732		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	24924298		★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	32508528	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25545807, 26414614, 26625115, 36815315, 40613333	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	Pubtator	31474164	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	31721052		★☆☆☆☆ Found in Text Mining only
Anaphylaxis	Anaphylaxis	Pubtator	30189430	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	19054829		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	36199424	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27762264, 28245991, 28771614, 29886421, 30070336, 30468503		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19054829, 27792788, 28382703, 28936211		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	27792788	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	21148811	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25642940, 31287012, 35777820	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21592044, 27494826, 28810543		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27494826, 29486764, 36197221	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	22642593, 28771614, 29568119, 36944850	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27762264, 28245991, 28771614, 29886421, 30070336, 30468503		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27862781, 29869715, 30408584		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	21763322		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22939885		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22939885	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30281332		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32684831	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22417086, 33204302, 38350444	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24842612, 30018308		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37217993	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25128583, 27762264		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28771614	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	27017522, 27148736	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	27148736		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	36068612	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	33206327	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31263278, 31439414		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	18317529		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	29961347		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	25545807, 36815315	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	17853946, 22410349, 28961797, 29543509		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	30685385, 35876170	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25049118, 29093489		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25049118	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	29093489		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30918427	Associate	★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	30551457		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29534643		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal Diseases	BEFREE	21555403		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	25128583		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	25128583		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25128583		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	27409178	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19054829, 21763322, 22410349, 30685385		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	30685385, 33537747, 33790898	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	18628981		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18628981	Inhibit	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	25118167, 31118097		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	31118097	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19054829, 27932245		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	40613333	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30010135		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25840722		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28111922		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28111922		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28454543	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35856334	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37047308	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27862781, 30408584		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35856334	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29331667, 30478987		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27762264		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25840722		★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	34269788	Associate	★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	31474164	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30137027		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	40613333	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	18321350	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19536297	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32684831	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	38050264	Stimulate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	25939343	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32154187	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	31260499	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	27762264		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30805986		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19536297, 30518680	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21148811	Stimulate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25545807, 27670763		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	16733861		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17853946, 21763322, 22410349, 25347935, 29543509, 29568119, 30408584, 30685385, 31189465, 31546668		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	29568119, 30685385, 33537747, 33790898	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	28111922	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	28454543	Stimulate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	22410349, 29516326		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	21148811		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	21555403		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	24358193, 24918157		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34176389	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31354698		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	40613333	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25465376, 30810243		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20920231	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	15332392	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24842612	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31275318		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31854219	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	27940256, 28089248		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	27940256, 28089248		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27940256, 28089248, 30408584, 30446886		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	27940256, 28089248		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	21325597	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22939885		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30810243		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24842612, 30018308		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29095622		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24842612, 27862781, 28245991, 29093489, 29095622, 29730341, 30723587, 31440123		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26184544	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30010135		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	21421043, 27862781		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	36859461	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31721052		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	27762264		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25840803, 29568119, 29886421		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29568119, 34534607, 37730550	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	34534607	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	25840803		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	37147138	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	29961347		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24842612, 29093489, 29095622, 30810243		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31546668		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30805986		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24842612, 29095622		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28111922		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28111922, 28454543	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31581596		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29095622		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	15309732		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	15309732, 19442309	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31440123		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	LHGDN	17729416		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	24924298, 27624412, 29027827, 29779263		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	24924298	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	27448788	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	27624412, 31581596		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	37147138	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32908142	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	23407402	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30408584		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29017955, 36655999	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	37002627	Associate	★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	19713442		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	30281332		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30281332		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	30281332		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	15332392	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29730341		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	29730341		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19054829, 19713442, 23475790, 25642940, 26852644, 28382703, 30408584, 31287012		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	32508528	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	26166951	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	32508528	Stimulate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21421043, 24564241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21421043, 24564241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24564241	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Plaques	Senile Plaques	BEFREE	25545807		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	22136371, 33390769	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	35502507	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	11323674, 12792857, 16437719, 16907912, 17452516, 18008257, 18396215, 19396532, 19596984, 21855288, 22798017, 23364598, 23475790, 23571837, 26320130, 27966555, 28260057, 28824642, 29059148, 29844416, 30388897, 30832396, 31440123, 31537145, 31733681		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33769181	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34868341	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27697433, 28229304, 30910643		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	23364598		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34122331, 38197217	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	34122331	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	23571837		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21763322, 22410349, 30685385		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30446886		★☆☆☆☆ Found in Text Mining only