Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	54206
Gene name	ERBB receptor feedback inhibitor 1
Gene symbol	ERRFI1
Synonyms (NCBI Gene)	GENE-33MIG-6MIG6RALT
Chromosome	1
Chromosome location	1p36.23
Summary	ERRFI1 is a cytoplasmic protein whose expression is upregulated with cell growth (Wick et al., 1995 [PubMed 7641805]). It shares significant homology with the protein product of rat gene-33, which is induced during cell stress and mediates cell signaling

327

Show/Hide all (327)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006520	hsa-miR-200c-3p	Luciferase reporter assay	19671845
MIRT006520	hsa-miR-200c-3p	Luciferase reporter assay	19671845
MIRT006520	hsa-miR-200c-3p	Luciferase reporter assay	19671845
MIRT006520	hsa-miR-200c-3p	Luciferase reporter assay	19671845
MIRT006520	hsa-miR-200c-3p	Luciferase reporter assay	19671845
MIRT006520	hsa-miR-200c-3p	Luciferase reporter assay	19671845
MIRT016297	hsa-miR-193b-3p	Microarray	20304954
MIRT050678	hsa-miR-18a-5p	CLASH	23622248
MIRT043883	hsa-miR-378a-3p	CLASH	23622248
MIRT038059	hsa-miR-423-5p	CLASH	23622248
MIRT438088	hsa-miR-148a-3p	ImmunoblotLuciferase reporter assayqRT-PCR	24425048
MIRT438088	hsa-miR-148a-3p	ImmunoblotLuciferase reporter assayqRT-PCR	24425048
MIRT438088	hsa-miR-148a-3p	ImmunoblotLuciferase reporter assayqRT-PCR	24425048
MIRT438088	hsa-miR-148a-3p	ImmunoblotLuciferase reporter assayqRT-PCR	24425048
MIRT544041	hsa-miR-140-3p	PAR-CLIP	21572407
MIRT544040	hsa-miR-4678	PAR-CLIP	21572407
MIRT079652	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT544039	hsa-miR-586	PAR-CLIP	21572407
MIRT544038	hsa-miR-4495	PAR-CLIP	21572407
MIRT544037	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT544036	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT544035	hsa-miR-380-3p	PAR-CLIP	21572407
MIRT544034	hsa-miR-125b-2-3p	PAR-CLIP	21572407
MIRT544033	hsa-miR-331-5p	PAR-CLIP	21572407
MIRT079650	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT544032	hsa-miR-448	PAR-CLIP	21572407
MIRT544031	hsa-miR-675-3p	PAR-CLIP	21572407
MIRT544030	hsa-miR-6083	PAR-CLIP	21572407
MIRT024124	hsa-miR-200b-3p	PAR-CLIP	26701625
MIRT006520	hsa-miR-200c-3p	PAR-CLIP	26701625
MIRT016633	hsa-miR-429	PAR-CLIP	26701625
MIRT544041	hsa-miR-140-3p	PAR-CLIP	21572407
MIRT544040	hsa-miR-4678	PAR-CLIP	21572407
MIRT079652	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT544039	hsa-miR-586	PAR-CLIP	21572407
MIRT544038	hsa-miR-4495	PAR-CLIP	21572407
MIRT544037	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT544036	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT544035	hsa-miR-380-3p	PAR-CLIP	21572407
MIRT544034	hsa-miR-125b-2-3p	PAR-CLIP	21572407
MIRT544033	hsa-miR-331-5p	PAR-CLIP	21572407
MIRT079650	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT544032	hsa-miR-448	PAR-CLIP	21572407
MIRT544031	hsa-miR-675-3p	PAR-CLIP	21572407
MIRT544030	hsa-miR-6083	PAR-CLIP	21572407
MIRT969911	hsa-miR-1178	CLIP-seq
MIRT969912	hsa-miR-1183	CLIP-seq
MIRT969913	hsa-miR-1184	CLIP-seq
MIRT969914	hsa-miR-1236	CLIP-seq
MIRT969915	hsa-miR-125a-3p	CLIP-seq
MIRT969916	hsa-miR-1265	CLIP-seq
MIRT969917	hsa-miR-1290	CLIP-seq
MIRT969918	hsa-miR-1299	CLIP-seq
MIRT969919	hsa-miR-1301	CLIP-seq
MIRT969920	hsa-miR-1305	CLIP-seq
MIRT969921	hsa-miR-1324	CLIP-seq
MIRT969922	hsa-miR-141	CLIP-seq
MIRT969923	hsa-miR-148a	CLIP-seq
MIRT969924	hsa-miR-148b	CLIP-seq
MIRT969925	hsa-miR-152	CLIP-seq
MIRT969926	hsa-miR-200a	CLIP-seq
MIRT969927	hsa-miR-200b	CLIP-seq
MIRT969928	hsa-miR-200c	CLIP-seq
MIRT969929	hsa-miR-205	CLIP-seq
MIRT969930	hsa-miR-214	CLIP-seq
MIRT969931	hsa-miR-218	CLIP-seq
MIRT969932	hsa-miR-2355-3p	CLIP-seq
MIRT969933	hsa-miR-297	CLIP-seq
MIRT969934	hsa-miR-298	CLIP-seq
MIRT969935	hsa-miR-302f	CLIP-seq
MIRT969936	hsa-miR-30a	CLIP-seq
MIRT969937	hsa-miR-30b	CLIP-seq
MIRT969938	hsa-miR-30c	CLIP-seq
MIRT969939	hsa-miR-30d	CLIP-seq
MIRT969940	hsa-miR-30e	CLIP-seq
MIRT969941	hsa-miR-3115	CLIP-seq
MIRT969942	hsa-miR-3121-5p	CLIP-seq
MIRT969943	hsa-miR-3129-3p	CLIP-seq
MIRT969944	hsa-miR-3130-3p	CLIP-seq
MIRT969945	hsa-miR-3144-3p	CLIP-seq
MIRT969946	hsa-miR-3149	CLIP-seq
MIRT969947	hsa-miR-3163	CLIP-seq
MIRT969948	hsa-miR-3168	CLIP-seq
MIRT969949	hsa-miR-3174	CLIP-seq
MIRT969950	hsa-miR-3182	CLIP-seq
MIRT969951	hsa-miR-3200-5p	CLIP-seq
MIRT969952	hsa-miR-3202	CLIP-seq
MIRT969953	hsa-miR-323b-3p	CLIP-seq
MIRT969954	hsa-miR-330-3p	CLIP-seq
MIRT969955	hsa-miR-338-5p	CLIP-seq
MIRT969956	hsa-miR-3606	CLIP-seq
MIRT969957	hsa-miR-3607-3p	CLIP-seq
MIRT969958	hsa-miR-3613-5p	CLIP-seq
MIRT969959	hsa-miR-3619-5p	CLIP-seq
MIRT969960	hsa-miR-3646	CLIP-seq
MIRT969961	hsa-miR-3662	CLIP-seq
MIRT969962	hsa-miR-3663-3p	CLIP-seq
MIRT969963	hsa-miR-3671	CLIP-seq
MIRT969964	hsa-miR-3675-3p	CLIP-seq
MIRT969965	hsa-miR-3692	CLIP-seq
MIRT969966	hsa-miR-374c	CLIP-seq
MIRT969967	hsa-miR-3913-3p	CLIP-seq
MIRT969968	hsa-miR-3925-3p	CLIP-seq
MIRT969969	hsa-miR-3925-5p	CLIP-seq
MIRT969970	hsa-miR-3977	CLIP-seq
MIRT969971	hsa-miR-4267	CLIP-seq
MIRT969972	hsa-miR-4286	CLIP-seq
MIRT969973	hsa-miR-4291	CLIP-seq
MIRT969974	hsa-miR-4307	CLIP-seq
MIRT969975	hsa-miR-4325	CLIP-seq
MIRT969976	hsa-miR-4436a	CLIP-seq
MIRT969977	hsa-miR-4475	CLIP-seq
MIRT969978	hsa-miR-4477a	CLIP-seq
MIRT969979	hsa-miR-4501	CLIP-seq
MIRT969980	hsa-miR-4503	CLIP-seq
MIRT969981	hsa-miR-4504	CLIP-seq
MIRT969982	hsa-miR-450b-5p	CLIP-seq
MIRT969983	hsa-miR-4521	CLIP-seq
MIRT969984	hsa-miR-4528	CLIP-seq
MIRT969985	hsa-miR-4533	CLIP-seq
MIRT969986	hsa-miR-4643	CLIP-seq
MIRT969987	hsa-miR-4646-3p	CLIP-seq
MIRT969988	hsa-miR-466	CLIP-seq
MIRT969989	hsa-miR-4660	CLIP-seq
MIRT969990	hsa-miR-4668-3p	CLIP-seq
MIRT969991	hsa-miR-4677-3p	CLIP-seq
MIRT969992	hsa-miR-4680-3p	CLIP-seq
MIRT969993	hsa-miR-4682	CLIP-seq
MIRT969994	hsa-miR-4691-3p	CLIP-seq
MIRT969995	hsa-miR-4693-3p	CLIP-seq
MIRT969996	hsa-miR-4705	CLIP-seq
MIRT969997	hsa-miR-4728-3p	CLIP-seq
MIRT969998	hsa-miR-4729	CLIP-seq
MIRT969999	hsa-miR-4753-3p	CLIP-seq
MIRT970000	hsa-miR-4762-3p	CLIP-seq
MIRT970001	hsa-miR-4764-5p	CLIP-seq
MIRT970002	hsa-miR-4768-5p	CLIP-seq
MIRT970003	hsa-miR-4778-3p	CLIP-seq
MIRT970004	hsa-miR-4778-5p	CLIP-seq
MIRT970005	hsa-miR-4789-3p	CLIP-seq
MIRT970006	hsa-miR-4793-3p	CLIP-seq
MIRT970007	hsa-miR-4795-3p	CLIP-seq
MIRT970008	hsa-miR-4802-3p	CLIP-seq
MIRT970009	hsa-miR-485-3p	CLIP-seq
MIRT970010	hsa-miR-489	CLIP-seq
MIRT970011	hsa-miR-490-3p	CLIP-seq
MIRT970012	hsa-miR-498	CLIP-seq
MIRT970013	hsa-miR-500a	CLIP-seq
MIRT970014	hsa-miR-501-5p	CLIP-seq
MIRT970015	hsa-miR-5047	CLIP-seq
MIRT970016	hsa-miR-507	CLIP-seq
MIRT970017	hsa-miR-515-5p	CLIP-seq
MIRT970018	hsa-miR-542-3p	CLIP-seq
MIRT970019	hsa-miR-548a-3p	CLIP-seq
MIRT970020	hsa-miR-548e	CLIP-seq
MIRT970021	hsa-miR-548f	CLIP-seq
MIRT970022	hsa-miR-548g	CLIP-seq
MIRT970023	hsa-miR-552	CLIP-seq
MIRT970024	hsa-miR-557	CLIP-seq
MIRT970025	hsa-miR-567	CLIP-seq
MIRT970026	hsa-miR-576-3p	CLIP-seq
MIRT970027	hsa-miR-577	CLIP-seq
MIRT970028	hsa-miR-579	CLIP-seq
MIRT970029	hsa-miR-581	CLIP-seq
MIRT970030	hsa-miR-584	CLIP-seq
MIRT970031	hsa-miR-587	CLIP-seq
MIRT970032	hsa-miR-601	CLIP-seq
MIRT970033	hsa-miR-607	CLIP-seq
MIRT970034	hsa-miR-610	CLIP-seq
MIRT970035	hsa-miR-622	CLIP-seq
MIRT970036	hsa-miR-627	CLIP-seq
MIRT970037	hsa-miR-636	CLIP-seq
MIRT970038	hsa-miR-649	CLIP-seq
MIRT970039	hsa-miR-655	CLIP-seq
MIRT970040	hsa-miR-656	CLIP-seq
MIRT970041	hsa-miR-761	CLIP-seq
MIRT970042	hsa-miR-766	CLIP-seq
MIRT970043	hsa-miR-802	CLIP-seq
MIRT970044	hsa-miR-875-3p	CLIP-seq
MIRT970045	hsa-miR-921	CLIP-seq
MIRT970046	hsa-miR-922	CLIP-seq
MIRT970047	hsa-miR-924	CLIP-seq
MIRT970048	hsa-miR-942	CLIP-seq
MIRT969920	hsa-miR-1305	CLIP-seq
MIRT969934	hsa-miR-298	CLIP-seq
MIRT1548436	hsa-miR-3148	CLIP-seq
MIRT969986	hsa-miR-4643	CLIP-seq
MIRT969988	hsa-miR-466	CLIP-seq
MIRT970005	hsa-miR-4789-3p	CLIP-seq
MIRT969912	hsa-miR-1183	CLIP-seq
MIRT969914	hsa-miR-1236	CLIP-seq
MIRT1987501	hsa-miR-1293	CLIP-seq
MIRT969923	hsa-miR-148a	CLIP-seq
MIRT969924	hsa-miR-148b	CLIP-seq
MIRT969925	hsa-miR-152	CLIP-seq
MIRT969927	hsa-miR-200b	CLIP-seq
MIRT969928	hsa-miR-200c	CLIP-seq
MIRT969931	hsa-miR-218	CLIP-seq
MIRT969934	hsa-miR-298	CLIP-seq
MIRT969941	hsa-miR-3115	CLIP-seq
MIRT969945	hsa-miR-3144-3p	CLIP-seq
MIRT969948	hsa-miR-3168	CLIP-seq
MIRT969950	hsa-miR-3182	CLIP-seq
MIRT969951	hsa-miR-3200-5p	CLIP-seq
MIRT1987502	hsa-miR-3647-3p	CLIP-seq
MIRT1987503	hsa-miR-3649	CLIP-seq
MIRT969964	hsa-miR-3675-3p	CLIP-seq
MIRT969965	hsa-miR-3692	CLIP-seq
MIRT1987504	hsa-miR-4276	CLIP-seq
MIRT969972	hsa-miR-4286	CLIP-seq
MIRT969974	hsa-miR-4307	CLIP-seq
MIRT1987505	hsa-miR-4310	CLIP-seq
MIRT969977	hsa-miR-4475	CLIP-seq
MIRT1987506	hsa-miR-4483	CLIP-seq
MIRT969980	hsa-miR-4503	CLIP-seq
MIRT1987507	hsa-miR-4648	CLIP-seq
MIRT1987508	hsa-miR-4668-5p	CLIP-seq
MIRT969993	hsa-miR-4682	CLIP-seq
MIRT969999	hsa-miR-4753-3p	CLIP-seq
MIRT1987509	hsa-miR-495	CLIP-seq
MIRT1987510	hsa-miR-556-5p	CLIP-seq
MIRT970027	hsa-miR-577	CLIP-seq
MIRT970030	hsa-miR-584	CLIP-seq
MIRT970031	hsa-miR-587	CLIP-seq
MIRT970034	hsa-miR-610	CLIP-seq
MIRT970036	hsa-miR-627	CLIP-seq
MIRT970037	hsa-miR-636	CLIP-seq
MIRT1987511	hsa-miR-873	CLIP-seq
MIRT970047	hsa-miR-924	CLIP-seq
MIRT970048	hsa-miR-942	CLIP-seq
MIRT2221911	hsa-miR-10a	CLIP-seq
MIRT2221912	hsa-miR-10b	CLIP-seq
MIRT969911	hsa-miR-1178	CLIP-seq
MIRT969912	hsa-miR-1183	CLIP-seq
MIRT969923	hsa-miR-148a	CLIP-seq
MIRT969924	hsa-miR-148b	CLIP-seq
MIRT969925	hsa-miR-152	CLIP-seq
MIRT969927	hsa-miR-200b	CLIP-seq
MIRT969928	hsa-miR-200c	CLIP-seq
MIRT2221913	hsa-miR-217	CLIP-seq
MIRT969932	hsa-miR-2355-3p	CLIP-seq
MIRT969934	hsa-miR-298	CLIP-seq
MIRT969942	hsa-miR-3121-5p	CLIP-seq
MIRT969947	hsa-miR-3163	CLIP-seq
MIRT969951	hsa-miR-3200-5p	CLIP-seq
MIRT969953	hsa-miR-323b-3p	CLIP-seq
MIRT969960	hsa-miR-3646	CLIP-seq
MIRT969961	hsa-miR-3662	CLIP-seq
MIRT969965	hsa-miR-3692	CLIP-seq
MIRT969972	hsa-miR-4286	CLIP-seq
MIRT969974	hsa-miR-4307	CLIP-seq
MIRT1987505	hsa-miR-4310	CLIP-seq
MIRT969976	hsa-miR-4436a	CLIP-seq
MIRT969986	hsa-miR-4643	CLIP-seq
MIRT969987	hsa-miR-4646-3p	CLIP-seq
MIRT969988	hsa-miR-466	CLIP-seq
MIRT969990	hsa-miR-4668-3p	CLIP-seq
MIRT969991	hsa-miR-4677-3p	CLIP-seq
MIRT969993	hsa-miR-4682	CLIP-seq
MIRT969994	hsa-miR-4691-3p	CLIP-seq
MIRT969995	hsa-miR-4693-3p	CLIP-seq
MIRT2221914	hsa-miR-4698	CLIP-seq
MIRT2221915	hsa-miR-4711-3p	CLIP-seq
MIRT970003	hsa-miR-4778-3p	CLIP-seq
MIRT970005	hsa-miR-4789-3p	CLIP-seq
MIRT1987509	hsa-miR-495	CLIP-seq
MIRT970013	hsa-miR-500a	CLIP-seq
MIRT970014	hsa-miR-501-5p	CLIP-seq
MIRT970031	hsa-miR-587	CLIP-seq
MIRT970035	hsa-miR-622	CLIP-seq
MIRT970036	hsa-miR-627	CLIP-seq
MIRT970047	hsa-miR-924	CLIP-seq
MIRT969912	hsa-miR-1183	CLIP-seq
MIRT969914	hsa-miR-1236	CLIP-seq
MIRT1987501	hsa-miR-1293	CLIP-seq
MIRT969927	hsa-miR-200b	CLIP-seq
MIRT969928	hsa-miR-200c	CLIP-seq
MIRT969949	hsa-miR-3174	CLIP-seq
MIRT969951	hsa-miR-3200-5p	CLIP-seq
MIRT2387536	hsa-miR-3591-3p	CLIP-seq
MIRT969956	hsa-miR-3606	CLIP-seq
MIRT2387537	hsa-miR-3610	CLIP-seq
MIRT1987502	hsa-miR-3647-3p	CLIP-seq
MIRT1987503	hsa-miR-3649	CLIP-seq
MIRT969968	hsa-miR-3925-3p	CLIP-seq
MIRT969971	hsa-miR-4267	CLIP-seq
MIRT1987504	hsa-miR-4276	CLIP-seq
MIRT969972	hsa-miR-4286	CLIP-seq
MIRT969976	hsa-miR-4436a	CLIP-seq
MIRT1987506	hsa-miR-4483	CLIP-seq
MIRT1987507	hsa-miR-4648	CLIP-seq
MIRT969993	hsa-miR-4682	CLIP-seq
MIRT970007	hsa-miR-4795-3p	CLIP-seq
MIRT970017	hsa-miR-515-5p	CLIP-seq
MIRT970031	hsa-miR-587	CLIP-seq
MIRT970034	hsa-miR-610	CLIP-seq
MIRT970036	hsa-miR-627	CLIP-seq
MIRT970042	hsa-miR-766	CLIP-seq
MIRT1987511	hsa-miR-873	CLIP-seq
MIRT970045	hsa-miR-921	CLIP-seq
MIRT970047	hsa-miR-924	CLIP-seq
MIRT969951	hsa-miR-3200-5p	CLIP-seq
MIRT969972	hsa-miR-4286	CLIP-seq
MIRT969993	hsa-miR-4682	CLIP-seq
MIRT970031	hsa-miR-587	CLIP-seq
MIRT970036	hsa-miR-627	CLIP-seq
MIRT970047	hsa-miR-924	CLIP-seq
MIRT1987501	hsa-miR-1293	CLIP-seq
MIRT969951	hsa-miR-3200-5p	CLIP-seq
MIRT1987503	hsa-miR-3649	CLIP-seq
MIRT1987504	hsa-miR-4276	CLIP-seq
MIRT969972	hsa-miR-4286	CLIP-seq
MIRT1987506	hsa-miR-4483	CLIP-seq
MIRT1987507	hsa-miR-4648	CLIP-seq
MIRT969993	hsa-miR-4682	CLIP-seq
MIRT1987510	hsa-miR-556-5p	CLIP-seq
MIRT970031	hsa-miR-587	CLIP-seq
MIRT970034	hsa-miR-610	CLIP-seq
MIRT970036	hsa-miR-627	CLIP-seq
MIRT1987511	hsa-miR-873	CLIP-seq
MIRT970047	hsa-miR-924	CLIP-seq
MIRT969951	hsa-miR-3200-5p	CLIP-seq
MIRT969972	hsa-miR-4286	CLIP-seq
MIRT969993	hsa-miR-4682	CLIP-seq
MIRT970031	hsa-miR-587	CLIP-seq
MIRT970036	hsa-miR-627	CLIP-seq
MIRT970047	hsa-miR-924	CLIP-seq

Show/Hide all (72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	IEA
GO:0001889	Process	Liver development	IEA
GO:0001894	Process	Tissue homeostasis	IEA
GO:0005096	Function	GTPase activator activity	TAS	10749885
GO:0005515	Function	Protein binding	IPI	15778465, 18046415, 18776048, 20936779, 21706016, 21988832, 22505024, 23273428, 24189400, 25640309, 28514442, 31980649, 32296183, 33961781, 34591642, 35384245, 35512704
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	10749885
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006699	Process	Bile acid biosynthetic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0007175	Process	Negative regulation of epidermal growth factor-activated receptor activity	IDA	18046415
GO:0007175	Process	Negative regulation of epidermal growth factor-activated receptor activity	ISS
GO:0007566	Process	Embryo implantation	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010467	Process	Gene expression	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	18046415
GO:0031267	Function	Small GTPase binding	IEA
GO:0031953	Process	Negative regulation of protein autophosphorylation	IDA	18046415
GO:0032355	Process	Response to estradiol	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IEA
GO:0035847	Process	Uterine epithelium development	IEA
GO:0035988	Process	Chondrocyte proliferation	IEA
GO:0036022	Process	Limb joint morphogenesis	IEA
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	IBA
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	IEA
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043588	Process	Skin development	IEA
GO:0043589	Process	Skin morphogenesis	IEA
GO:0043589	Process	Skin morphogenesis	ISS
GO:0045616	Process	Regulation of keratinocyte differentiation	IBA
GO:0045616	Process	Regulation of keratinocyte differentiation	IEA
GO:0045616	Process	Regulation of keratinocyte differentiation	ISS
GO:0048286	Process	Lung alveolus development	IEA
GO:0048286	Process	Lung alveolus development	ISS
GO:0048545	Process	Response to steroid hormone	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050847	Process	Progesterone receptor signaling pathway	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0060065	Process	Uterus development	IEA
GO:0060426	Process	Lung vasculature development	IEA
GO:0060426	Process	Lung vasculature development	ISS
GO:0060428	Process	Lung epithelium development	IEA
GO:0060428	Process	Lung epithelium development	ISS
GO:0060429	Process	Epithelium development	IEA
GO:0060613	Process	Fat pad development	IEA
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0071474	Process	Cellular hyperosmotic response	IEA
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:1903243	Process	Negative regulation of cardiac muscle hypertrophy in response to stress	IEA
GO:1904565	Process	Response to 1-oleoyl-sn-glycerol 3-phosphate	IEA

MIM	HGNC	e!Ensembl
608069	18185	ENSG00000116285

Q9UJM3

Protein name

ERBB receptor feedback inhibitor 1 (Mitogen-inducible gene 6 protein) (MIG-6)

Protein function

Negative regulator of EGFR signaling in skin morphogenesis. Acts as a negative regulator for several EGFR family members, including ERBB2, ERBB3 and ERBB4. Inhibits EGFR catalytic activity by interfering with its dimerization. Inhibits autophosp

PDB

2RF9 , 2RFD , 2RFE , 4I21 , 4R3P , 4R3R , 4ZJV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09027	GTPase_binding	6 → 68	GTPase binding	Domain
PF11555	Inhibitor_Mig-6	315 → 371	EGFR receptor inhibitor Mig-6	Family

Sequence

MSIAGVAAQEIRVPLKTGFLHNGRAMGNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSA
QERLIPLGHASKSAPMNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTV
NGVCASTPPLTPIKNSPSLFPCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTD
FLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAADLSYVSDQNGGVPDPNPPPP
QTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRR
WSAEVTSSTYSDEDRPPKVPPREPLSPSNSRTPSPKSLPSYLNGVMPPTQSFAPDPKYVS
SKALQRQNSEGSASKVPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKFFREAEETNGG
AQIQPLPADCGISSATEKPDSKTKMDLGGHVKRKHLSYVVSP

Sequence length

462

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (73)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	16819504, 29191600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25735773, 25941338, 29196224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	37699925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15856022, 15952054, 21289334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27341132, 33046784	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32377505, 32432675, 35441810, 35859293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12387890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26760771, 27557663	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17006932, 28734040, 35165519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16819504, 24573418, 25400829, 27346601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31313286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23324575, 24989997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23324575, 24989997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23324575, 35301888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23324575, 35301888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24989997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23324575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23324575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10749885, 23324575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	19439667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19439667, 25377472, 26450625, 27910070, 28516379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Diseases	Endometrial Diseases	BEFREE	19439667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	27910070, 28516379, 29843645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	28516379	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	36498921	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28516379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36498921	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34845855	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21113414, 24425048, 26280531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21113414, 26280531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21113414, 24425048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26280531, 36231068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	28588707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	17006932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	17006932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	35301888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25594850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12387890	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30817728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17006932, 25594850, 28506767, 28734040, 30249105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16819504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22701735, 28688920, 37834326, 38060494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25735773, 29191600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15856022, 15952054, 21289334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19439667, 25377472, 27910070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16819504, 24445374, 24573418, 25400829, 27346601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21190978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17351343, 19040996, 26280531, 29714661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15856022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22701735, 26967478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26967478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37070291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16819504, 17351343, 19040996, 21113414, 21190978, 21739478, 24550739, 24573418, 25377472, 25622905, 25735773, 25941338, 26065894, 26450625, 27893711 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17940511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36108156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21739478, 24573418, 25400829, 31069016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19040996, 21190978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21411543	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progesterone Resistance	Progesterone Resistance	BEFREE	26450625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18712736, 22193779, 36008945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	16648858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	37699925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36007290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	26967478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21190978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	19040996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21190978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32377505, 32432675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ERRFI1 (ERBB receptor feedback inhibitor 1)