PODXL (podocalyxin like)

Gene

• Entrez ID: 5420
• Gene name: Podocalyxin like
• Gene symbol: PODXL
• Synonyms (NCBI Gene): Gp200, PC, PCLP, PCLP-1, PDX, PODXL1, gp135
• Chromosome: 7
• Chromosome location: 7q32.3
• Summary: This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs55698400	T>G	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs1554391082	->GGCGACGG	Likely-pathogenic, uncertain-significance	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001522	hsa-miR-155-5p	pSILAC	18668040
MIRT002657	hsa-miR-124-3p	Microarray	15685193
MIRT006811	hsa-miR-199b-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	22374871
MIRT006811	hsa-miR-199b-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	22374871
MIRT001522	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT021537	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT002657	hsa-miR-124-3p	Microarray	18668037
MIRT002657	hsa-miR-124-3p	Microarray	15685193
MIRT024915	hsa-miR-215-5p	Microarray	19074876
MIRT026206	hsa-miR-192-5p	Microarray	19074876
MIRT028791	hsa-miR-26b-5p	Microarray	19088304
MIRT021537	hsa-miR-145-5p	qRT-PCR	23312222
MIRT021537	hsa-miR-145-5p	qRT-PCR	23312222
MIRT715956	hsa-miR-186-5p	HITS-CLIP	19536157
MIRT715955	hsa-miR-6507-5p	HITS-CLIP	19536157
MIRT715954	hsa-miR-4778-5p	HITS-CLIP	19536157
MIRT715953	hsa-miR-3686	HITS-CLIP	19536157
MIRT700705	hsa-miR-199a-5p	HITS-CLIP	23313552
MIRT006811	hsa-miR-199b-5p	HITS-CLIP	23313552
MIRT021537	hsa-miR-145-5p	HITS-CLIP	23313552
MIRT700704	hsa-miR-5195-3p	HITS-CLIP	23313552
MIRT700703	hsa-miR-10a-3p	HITS-CLIP	23313552
MIRT700702	hsa-miR-545-5p	HITS-CLIP	23313552
MIRT700701	hsa-miR-1825	HITS-CLIP	23313552
MIRT700700	hsa-miR-4797-3p	HITS-CLIP	23313552
MIRT700699	hsa-miR-4264	HITS-CLIP	23313552
MIRT700698	hsa-miR-520d-5p	HITS-CLIP	23313552
MIRT700697	hsa-miR-524-5p	HITS-CLIP	23313552
MIRT559891	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT559890	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT559889	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT559888	hsa-miR-4308	PAR-CLIP	20371350
MIRT559887	hsa-miR-4292	PAR-CLIP	20371350
MIRT559886	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT559885	hsa-miR-4456	PAR-CLIP	20371350
MIRT559884	hsa-miR-5093	PAR-CLIP	20371350
MIRT559883	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT559882	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT559881	hsa-miR-8071	PAR-CLIP	20371350
MIRT559880	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT559879	hsa-miR-3165	PAR-CLIP	20371350
MIRT559878	hsa-miR-3677-3p	PAR-CLIP	20371350
MIRT559877	hsa-miR-6079	PAR-CLIP	20371350
MIRT535101	hsa-miR-449b-5p	PAR-CLIP	22012620
MIRT535100	hsa-miR-34c-5p	PAR-CLIP	22012620
MIRT535099	hsa-miR-449a	PAR-CLIP	22012620
MIRT535098	hsa-miR-34a-5p	PAR-CLIP	22012620
MIRT535097	hsa-miR-4446-3p	PAR-CLIP	22012620
MIRT535096	hsa-miR-570-3p	PAR-CLIP	22012620
MIRT535095	hsa-miR-4721	PAR-CLIP	22012620
MIRT535094	hsa-miR-5589-5p	PAR-CLIP	22012620
MIRT535093	hsa-miR-1249-5p	PAR-CLIP	22012620
MIRT535092	hsa-miR-6797-5p	PAR-CLIP	22012620
MIRT535091	hsa-miR-548au-3p	PAR-CLIP	22012620
MIRT470740	hsa-miR-4505	PAR-CLIP	22012620
MIRT470738	hsa-miR-5787	PAR-CLIP	22012620
MIRT535090	hsa-miR-4492	PAR-CLIP	22012620
MIRT535089	hsa-miR-4498	PAR-CLIP	22012620
MIRT535088	hsa-miR-5001-5p	PAR-CLIP	22012620
MIRT535087	hsa-miR-762	PAR-CLIP	22012620
MIRT535086	hsa-miR-7847-3p	PAR-CLIP	22012620
MIRT535085	hsa-miR-6515-5p	PAR-CLIP	22012620
MIRT535084	hsa-miR-182-5p	PAR-CLIP	22012620
MIRT535083	hsa-miR-1271-5p	PAR-CLIP	22012620
MIRT535082	hsa-miR-96-5p	PAR-CLIP	22012620
MIRT470748	hsa-miR-6779-3p	PAR-CLIP	23592263
MIRT470747	hsa-miR-3605-3p	PAR-CLIP	23592263
MIRT470746	hsa-miR-3064-5p	PAR-CLIP	23592263
MIRT470744	hsa-miR-6504-5p	PAR-CLIP	23592263
MIRT470745	hsa-miR-626	PAR-CLIP	23592263
MIRT470743	hsa-miR-6876-3p	PAR-CLIP	23592263
MIRT470742	hsa-miR-3652	PAR-CLIP	23592263
MIRT470741	hsa-miR-4430	PAR-CLIP	23592263
MIRT470740	hsa-miR-4505	PAR-CLIP	23592263
MIRT470738	hsa-miR-5787	PAR-CLIP	23592263
MIRT470739	hsa-miR-6842-3p	PAR-CLIP	23592263
MIRT559889	hsa-miR-186-3p	PAR-CLIP	26701625
MIRT559889	hsa-miR-186-3p	PAR-CLIP	26701625
MIRT559889	hsa-miR-186-3p	PAR-CLIP	26701625
MIRT559889	hsa-miR-186-3p	PAR-CLIP	26701625
MIRT559889	hsa-miR-186-3p	PAR-CLIP	26701625
MIRT559890	hsa-miR-2114-5p	PAR-CLIP	26701625
MIRT559890	hsa-miR-2114-5p	PAR-CLIP	26701625
MIRT559890	hsa-miR-2114-5p	PAR-CLIP	26701625
MIRT559890	hsa-miR-2114-5p	PAR-CLIP	26701625
MIRT559879	hsa-miR-3165	PAR-CLIP	26701625
MIRT559879	hsa-miR-3165	PAR-CLIP	26701625
MIRT559879	hsa-miR-3165	PAR-CLIP	26701625
MIRT559879	hsa-miR-3165	PAR-CLIP	26701625
MIRT559879	hsa-miR-3165	PAR-CLIP	26701625
MIRT559878	hsa-miR-3677-3p	PAR-CLIP	26701625
MIRT559878	hsa-miR-3677-3p	PAR-CLIP	26701625
MIRT559878	hsa-miR-3677-3p	PAR-CLIP	26701625
MIRT559878	hsa-miR-3677-3p	PAR-CLIP	26701625
MIRT559878	hsa-miR-3677-3p	PAR-CLIP	26701625
MIRT559887	hsa-miR-4292	PAR-CLIP	26701625
MIRT559887	hsa-miR-4292	PAR-CLIP	26701625
MIRT559887	hsa-miR-4292	PAR-CLIP	26701625
MIRT559887	hsa-miR-4292	PAR-CLIP	26701625
MIRT559887	hsa-miR-4292	PAR-CLIP	26701625
MIRT559888	hsa-miR-4308	PAR-CLIP	26701625
MIRT559888	hsa-miR-4308	PAR-CLIP	26701625
MIRT559888	hsa-miR-4308	PAR-CLIP	26701625
MIRT559888	hsa-miR-4308	PAR-CLIP	26701625
MIRT559888	hsa-miR-4308	PAR-CLIP	26701625
MIRT559885	hsa-miR-4456	PAR-CLIP	26701625
MIRT559885	hsa-miR-4456	PAR-CLIP	26701625
MIRT559885	hsa-miR-4456	PAR-CLIP	26701625
MIRT559885	hsa-miR-4456	PAR-CLIP	26701625
MIRT559885	hsa-miR-4456	PAR-CLIP	26701625
MIRT559891	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT559891	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT559891	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT559891	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT559891	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT559884	hsa-miR-5093	PAR-CLIP	26701625
MIRT559884	hsa-miR-5093	PAR-CLIP	26701625
MIRT559884	hsa-miR-5093	PAR-CLIP	26701625
MIRT559884	hsa-miR-5093	PAR-CLIP	26701625
MIRT559884	hsa-miR-5093	PAR-CLIP	26701625
MIRT559877	hsa-miR-6079	PAR-CLIP	26701625
MIRT559877	hsa-miR-6079	PAR-CLIP	26701625
MIRT559877	hsa-miR-6079	PAR-CLIP	26701625
MIRT559877	hsa-miR-6079	PAR-CLIP	26701625
MIRT559877	hsa-miR-6079	PAR-CLIP	26701625
MIRT559882	hsa-miR-671-5p	PAR-CLIP	26701625
MIRT559882	hsa-miR-671-5p	PAR-CLIP	26701625
MIRT559882	hsa-miR-671-5p	PAR-CLIP	26701625
MIRT559882	hsa-miR-671-5p	PAR-CLIP	26701625
MIRT559882	hsa-miR-671-5p	PAR-CLIP	26701625
MIRT559886	hsa-miR-6791-5p	PAR-CLIP	26701625
MIRT559886	hsa-miR-6791-5p	PAR-CLIP	26701625
MIRT559886	hsa-miR-6791-5p	PAR-CLIP	26701625
MIRT559886	hsa-miR-6791-5p	PAR-CLIP	26701625
MIRT559886	hsa-miR-6791-5p	PAR-CLIP	26701625
MIRT559883	hsa-miR-6828-5p	PAR-CLIP	26701625
MIRT559883	hsa-miR-6828-5p	PAR-CLIP	26701625
MIRT559883	hsa-miR-6828-5p	PAR-CLIP	26701625
MIRT559883	hsa-miR-6828-5p	PAR-CLIP	26701625
MIRT559883	hsa-miR-6828-5p	PAR-CLIP	26701625
MIRT559880	hsa-miR-6880-5p	PAR-CLIP	26701625
MIRT559880	hsa-miR-6880-5p	PAR-CLIP	26701625
MIRT559880	hsa-miR-6880-5p	PAR-CLIP	26701625
MIRT559880	hsa-miR-6880-5p	PAR-CLIP	26701625
MIRT559880	hsa-miR-6880-5p	PAR-CLIP	26701625
MIRT559881	hsa-miR-8071	PAR-CLIP	26701625
MIRT559881	hsa-miR-8071	PAR-CLIP	26701625
MIRT559881	hsa-miR-8071	PAR-CLIP	26701625
MIRT559881	hsa-miR-8071	PAR-CLIP	26701625
MIRT559881	hsa-miR-8071	PAR-CLIP	26701625
MIRT715956	hsa-miR-186-5p	HITS-CLIP	19536157
MIRT715955	hsa-miR-6507-5p	HITS-CLIP	19536157
MIRT715954	hsa-miR-4778-5p	HITS-CLIP	19536157
MIRT715953	hsa-miR-3686	HITS-CLIP	19536157
MIRT700705	hsa-miR-199a-5p	HITS-CLIP	23313552
MIRT006811	hsa-miR-199b-5p	HITS-CLIP	23313552
MIRT021537	hsa-miR-145-5p	HITS-CLIP	23313552
MIRT700704	hsa-miR-5195-3p	HITS-CLIP	23313552
MIRT700703	hsa-miR-10a-3p	HITS-CLIP	23313552
MIRT700702	hsa-miR-545-5p	HITS-CLIP	23313552
MIRT700701	hsa-miR-1825	HITS-CLIP	23313552
MIRT700700	hsa-miR-4797-3p	HITS-CLIP	23313552
MIRT700699	hsa-miR-4264	HITS-CLIP	23313552
MIRT700698	hsa-miR-520d-5p	HITS-CLIP	23313552
MIRT700697	hsa-miR-524-5p	HITS-CLIP	23313552
MIRT559891	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT559890	hsa-miR-2114-5p	PAR-CLIP	20371350
MIRT559889	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT559888	hsa-miR-4308	PAR-CLIP	20371350
MIRT559887	hsa-miR-4292	PAR-CLIP	20371350
MIRT559886	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT559885	hsa-miR-4456	PAR-CLIP	20371350
MIRT559884	hsa-miR-5093	PAR-CLIP	20371350
MIRT559883	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT559882	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT559881	hsa-miR-8071	PAR-CLIP	20371350
MIRT559880	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT559879	hsa-miR-3165	PAR-CLIP	20371350
MIRT559878	hsa-miR-3677-3p	PAR-CLIP	20371350
MIRT559877	hsa-miR-6079	PAR-CLIP	20371350
MIRT535101	hsa-miR-449b-5p	PAR-CLIP	22012620
MIRT535100	hsa-miR-34c-5p	PAR-CLIP	22012620
MIRT535099	hsa-miR-449a	PAR-CLIP	22012620
MIRT535098	hsa-miR-34a-5p	PAR-CLIP	22012620
MIRT535097	hsa-miR-4446-3p	PAR-CLIP	22012620
MIRT535096	hsa-miR-570-3p	PAR-CLIP	22012620
MIRT535095	hsa-miR-4721	PAR-CLIP	22012620
MIRT535094	hsa-miR-5589-5p	PAR-CLIP	22012620
MIRT535093	hsa-miR-1249-5p	PAR-CLIP	22012620
MIRT535092	hsa-miR-6797-5p	PAR-CLIP	22012620
MIRT535091	hsa-miR-548au-3p	PAR-CLIP	22012620
MIRT470740	hsa-miR-4505	PAR-CLIP	22012620
MIRT470738	hsa-miR-5787	PAR-CLIP	22012620
MIRT535090	hsa-miR-4492	PAR-CLIP	22012620
MIRT535089	hsa-miR-4498	PAR-CLIP	22012620
MIRT535088	hsa-miR-5001-5p	PAR-CLIP	22012620
MIRT535087	hsa-miR-762	PAR-CLIP	22012620
MIRT535086	hsa-miR-7847-3p	PAR-CLIP	22012620
MIRT535085	hsa-miR-6515-5p	PAR-CLIP	22012620
MIRT535084	hsa-miR-182-5p	PAR-CLIP	22012620
MIRT535083	hsa-miR-1271-5p	PAR-CLIP	22012620
MIRT535082	hsa-miR-96-5p	PAR-CLIP	22012620
MIRT470748	hsa-miR-6779-3p	PAR-CLIP	23592263
MIRT470747	hsa-miR-3605-3p	PAR-CLIP	23592263
MIRT470746	hsa-miR-3064-5p	PAR-CLIP	23592263
MIRT470744	hsa-miR-6504-5p	PAR-CLIP	23592263
MIRT470745	hsa-miR-626	PAR-CLIP	23592263
MIRT470743	hsa-miR-6876-3p	PAR-CLIP	23592263
MIRT470742	hsa-miR-3652	PAR-CLIP	23592263
MIRT470741	hsa-miR-4430	PAR-CLIP	23592263
MIRT470740	hsa-miR-4505	PAR-CLIP	23592263
MIRT470738	hsa-miR-5787	PAR-CLIP	23592263
MIRT470739	hsa-miR-6842-3p	PAR-CLIP	23592263
MIRT1246424	hsa-miR-1207-3p	CLIP-seq
MIRT1246425	hsa-miR-1208	CLIP-seq
MIRT1246426	hsa-miR-124	CLIP-seq
MIRT1246427	hsa-miR-125a-5p	CLIP-seq
MIRT1246428	hsa-miR-125b	CLIP-seq
MIRT1246429	hsa-miR-1288	CLIP-seq
MIRT1246430	hsa-miR-1305	CLIP-seq
MIRT1246431	hsa-miR-1307	CLIP-seq
MIRT1246432	hsa-miR-144	CLIP-seq
MIRT1246433	hsa-miR-145	CLIP-seq
MIRT1246434	hsa-miR-146b-3p	CLIP-seq
MIRT1246435	hsa-miR-148a	CLIP-seq
MIRT1246436	hsa-miR-148b	CLIP-seq
MIRT1246437	hsa-miR-152	CLIP-seq
MIRT1246438	hsa-miR-154	CLIP-seq
MIRT1246439	hsa-miR-155	CLIP-seq
MIRT1246440	hsa-miR-181a	CLIP-seq
MIRT1246441	hsa-miR-181b	CLIP-seq
MIRT1246442	hsa-miR-181c	CLIP-seq
MIRT1246443	hsa-miR-181d	CLIP-seq
MIRT1246444	hsa-miR-184	CLIP-seq
MIRT1246445	hsa-miR-1909	CLIP-seq
MIRT1246446	hsa-miR-198	CLIP-seq
MIRT1246447	hsa-miR-216a	CLIP-seq
MIRT1246448	hsa-miR-22	CLIP-seq
MIRT1246449	hsa-miR-298	CLIP-seq
MIRT1246450	hsa-miR-300	CLIP-seq
MIRT1246451	hsa-miR-3074-5p	CLIP-seq
MIRT1246452	hsa-miR-3140-3p	CLIP-seq
MIRT1246453	hsa-miR-3143	CLIP-seq
MIRT1246454	hsa-miR-3158-5p	CLIP-seq
MIRT1246455	hsa-miR-3173-5p	CLIP-seq
MIRT1246456	hsa-miR-3179	CLIP-seq
MIRT1246457	hsa-miR-3180-5p	CLIP-seq
MIRT1246458	hsa-miR-3187-3p	CLIP-seq
MIRT1246459	hsa-miR-3194-3p	CLIP-seq
MIRT1246460	hsa-miR-3199	CLIP-seq
MIRT1246461	hsa-miR-3607-5p	CLIP-seq
MIRT1246462	hsa-miR-3617	CLIP-seq
MIRT1246463	hsa-miR-3689a-3p	CLIP-seq
MIRT1246464	hsa-miR-3689c	CLIP-seq
MIRT1246465	hsa-miR-370	CLIP-seq
MIRT1246466	hsa-miR-375	CLIP-seq
MIRT1246467	hsa-miR-378	CLIP-seq
MIRT1246468	hsa-miR-378b	CLIP-seq
MIRT1246469	hsa-miR-378c	CLIP-seq
MIRT1246470	hsa-miR-378d	CLIP-seq
MIRT1246471	hsa-miR-378e	CLIP-seq
MIRT1246472	hsa-miR-378f	CLIP-seq
MIRT1246473	hsa-miR-378h	CLIP-seq
MIRT1246474	hsa-miR-378i	CLIP-seq
MIRT1246475	hsa-miR-381	CLIP-seq
MIRT1246476	hsa-miR-3919	CLIP-seq
MIRT1246477	hsa-miR-3973	CLIP-seq
MIRT1246478	hsa-miR-422a	CLIP-seq
MIRT1246479	hsa-miR-4255	CLIP-seq
MIRT1246480	hsa-miR-4262	CLIP-seq
MIRT1246481	hsa-miR-4300	CLIP-seq
MIRT1246482	hsa-miR-4302	CLIP-seq
MIRT1246483	hsa-miR-4319	CLIP-seq
MIRT1246484	hsa-miR-4324	CLIP-seq
MIRT1246485	hsa-miR-4326	CLIP-seq
MIRT1246486	hsa-miR-4418	CLIP-seq
MIRT1246487	hsa-miR-4421	CLIP-seq
MIRT1246488	hsa-miR-4422	CLIP-seq
MIRT1246489	hsa-miR-4435	CLIP-seq
MIRT1246490	hsa-miR-4487	CLIP-seq
MIRT1246491	hsa-miR-4519	CLIP-seq
MIRT1246492	hsa-miR-4520a-3p	CLIP-seq
MIRT1246493	hsa-miR-4529-5p	CLIP-seq
MIRT1246494	hsa-miR-4638-3p	CLIP-seq
MIRT1246495	hsa-miR-4638-5p	CLIP-seq
MIRT1246496	hsa-miR-4645-3p	CLIP-seq
MIRT1246497	hsa-miR-4653-3p	CLIP-seq
MIRT1246498	hsa-miR-4666-3p	CLIP-seq
MIRT1246499	hsa-miR-4699-3p	CLIP-seq
MIRT1246500	hsa-miR-4701-5p	CLIP-seq
MIRT1246501	hsa-miR-4712-5p	CLIP-seq
MIRT1246502	hsa-miR-4742-3p	CLIP-seq
MIRT1246503	hsa-miR-4803	CLIP-seq
MIRT1246504	hsa-miR-4804-5p	CLIP-seq
MIRT1246505	hsa-miR-506	CLIP-seq
MIRT1246506	hsa-miR-509-5p	CLIP-seq
MIRT1246507	hsa-miR-5096	CLIP-seq
MIRT1246508	hsa-miR-512-5p	CLIP-seq
MIRT1246509	hsa-miR-520a-5p	CLIP-seq
MIRT1246510	hsa-miR-520g	CLIP-seq
MIRT1246511	hsa-miR-520h	CLIP-seq
MIRT1246512	hsa-miR-525-5p	CLIP-seq
MIRT1246513	hsa-miR-548ae	CLIP-seq
MIRT1246514	hsa-miR-548aj	CLIP-seq
MIRT1246515	hsa-miR-548am	CLIP-seq
MIRT1246516	hsa-miR-548l	CLIP-seq
MIRT1246517	hsa-miR-548s	CLIP-seq
MIRT1246518	hsa-miR-548x	CLIP-seq
MIRT1246519	hsa-miR-567	CLIP-seq
MIRT1246520	hsa-miR-588	CLIP-seq
MIRT1246521	hsa-miR-607	CLIP-seq
MIRT1246522	hsa-miR-628-5p	CLIP-seq
MIRT1246523	hsa-miR-634	CLIP-seq
MIRT1246524	hsa-miR-641	CLIP-seq
MIRT1246525	hsa-miR-770-5p	CLIP-seq
MIRT1246526	hsa-miR-874	CLIP-seq
MIRT1246527	hsa-miR-920	CLIP-seq
MIRT1246528	hsa-miR-1202	CLIP-seq
MIRT1246529	hsa-miR-1298	CLIP-seq
MIRT1246530	hsa-miR-1301	CLIP-seq
MIRT1246430	hsa-miR-1305	CLIP-seq
MIRT1246431	hsa-miR-1307	CLIP-seq
MIRT1246531	hsa-miR-1343	CLIP-seq
MIRT1246532	hsa-miR-136	CLIP-seq
MIRT1246433	hsa-miR-145	CLIP-seq
MIRT1246435	hsa-miR-148a	CLIP-seq
MIRT1246436	hsa-miR-148b	CLIP-seq
MIRT1246437	hsa-miR-152	CLIP-seq
MIRT1246438	hsa-miR-154	CLIP-seq
MIRT1246439	hsa-miR-155	CLIP-seq
MIRT1246445	hsa-miR-1909	CLIP-seq
MIRT1246446	hsa-miR-198	CLIP-seq
MIRT1246533	hsa-miR-203	CLIP-seq
MIRT1246447	hsa-miR-216a	CLIP-seq
MIRT1246534	hsa-miR-28-3p	CLIP-seq
MIRT1246535	hsa-miR-296-3p	CLIP-seq
MIRT1246449	hsa-miR-298	CLIP-seq
MIRT1246451	hsa-miR-3074-5p	CLIP-seq
MIRT1246536	hsa-miR-3120-5p	CLIP-seq
MIRT1246537	hsa-miR-3124-3p	CLIP-seq
MIRT1246538	hsa-miR-3125	CLIP-seq
MIRT1246539	hsa-miR-3135	CLIP-seq
MIRT1246452	hsa-miR-3140-3p	CLIP-seq
MIRT1246453	hsa-miR-3143	CLIP-seq
MIRT1246540	hsa-miR-3148	CLIP-seq
MIRT1246541	hsa-miR-3153	CLIP-seq
MIRT1246454	hsa-miR-3158-5p	CLIP-seq
MIRT1246456	hsa-miR-3179	CLIP-seq
MIRT1246458	hsa-miR-3187-3p	CLIP-seq
MIRT1246542	hsa-miR-337-3p	CLIP-seq
MIRT1246543	hsa-miR-339-5p	CLIP-seq
MIRT1246544	hsa-miR-3667-3p	CLIP-seq
MIRT1246545	hsa-miR-3685	CLIP-seq
MIRT1246465	hsa-miR-370	CLIP-seq
MIRT1246467	hsa-miR-378	CLIP-seq
MIRT1246468	hsa-miR-378b	CLIP-seq
MIRT1246469	hsa-miR-378c	CLIP-seq
MIRT1246470	hsa-miR-378d	CLIP-seq
MIRT1246471	hsa-miR-378e	CLIP-seq
MIRT1246472	hsa-miR-378f	CLIP-seq
MIRT1246473	hsa-miR-378h	CLIP-seq
MIRT1246474	hsa-miR-378i	CLIP-seq
MIRT1246546	hsa-miR-384	CLIP-seq
MIRT1246547	hsa-miR-3916	CLIP-seq
MIRT1246476	hsa-miR-3919	CLIP-seq
MIRT1246548	hsa-miR-3972	CLIP-seq
MIRT1246477	hsa-miR-3973	CLIP-seq
MIRT1246478	hsa-miR-422a	CLIP-seq
MIRT1246479	hsa-miR-4255	CLIP-seq
MIRT1246549	hsa-miR-4299	CLIP-seq
MIRT1246485	hsa-miR-4326	CLIP-seq
MIRT1246486	hsa-miR-4418	CLIP-seq
MIRT1246487	hsa-miR-4421	CLIP-seq
MIRT1246488	hsa-miR-4422	CLIP-seq
MIRT1246489	hsa-miR-4435	CLIP-seq
MIRT1246550	hsa-miR-4436b-5p	CLIP-seq
MIRT1246491	hsa-miR-4519	CLIP-seq
MIRT1246492	hsa-miR-4520a-3p	CLIP-seq
MIRT1246493	hsa-miR-4529-5p	CLIP-seq
MIRT1246551	hsa-miR-4540	CLIP-seq
MIRT1246552	hsa-miR-4635	CLIP-seq
MIRT1246494	hsa-miR-4638-3p	CLIP-seq
MIRT1246495	hsa-miR-4638-5p	CLIP-seq
MIRT1246553	hsa-miR-4668-5p	CLIP-seq
MIRT1246500	hsa-miR-4701-5p	CLIP-seq
MIRT1246503	hsa-miR-4803	CLIP-seq
MIRT1246554	hsa-miR-502-5p	CLIP-seq
MIRT1246555	hsa-miR-5047	CLIP-seq
MIRT1246506	hsa-miR-509-5p	CLIP-seq
MIRT1246508	hsa-miR-512-5p	CLIP-seq
MIRT1246556	hsa-miR-515-5p	CLIP-seq
MIRT1246509	hsa-miR-520a-5p	CLIP-seq
MIRT1246510	hsa-miR-520g	CLIP-seq
MIRT1246511	hsa-miR-520h	CLIP-seq
MIRT1246512	hsa-miR-525-5p	CLIP-seq
MIRT1246557	hsa-miR-544	CLIP-seq
MIRT1246513	hsa-miR-548ae	CLIP-seq
MIRT1246514	hsa-miR-548aj	CLIP-seq
MIRT1246515	hsa-miR-548am	CLIP-seq
MIRT1246558	hsa-miR-548c-3p	CLIP-seq
MIRT1246516	hsa-miR-548l	CLIP-seq
MIRT1246559	hsa-miR-548q	CLIP-seq
MIRT1246517	hsa-miR-548s	CLIP-seq
MIRT1246518	hsa-miR-548x	CLIP-seq
MIRT1246560	hsa-miR-554	CLIP-seq
MIRT1246519	hsa-miR-567	CLIP-seq
MIRT1246520	hsa-miR-588	CLIP-seq
MIRT1246561	hsa-miR-604	CLIP-seq
MIRT1246521	hsa-miR-607	CLIP-seq
MIRT1246562	hsa-miR-621	CLIP-seq
MIRT1246522	hsa-miR-628-5p	CLIP-seq
MIRT1246563	hsa-miR-647	CLIP-seq
MIRT1552433	hsa-miR-1293	CLIP-seq
MIRT1552434	hsa-miR-4483	CLIP-seq
MIRT2072761	hsa-miR-361-3p	CLIP-seq
MIRT1246427	hsa-miR-125a-5p	CLIP-seq
MIRT1246428	hsa-miR-125b	CLIP-seq
MIRT2072762	hsa-miR-1273g	CLIP-seq
MIRT2072763	hsa-miR-1285	CLIP-seq
MIRT1246530	hsa-miR-1301	CLIP-seq
MIRT1246433	hsa-miR-145	CLIP-seq
MIRT2072764	hsa-miR-15a	CLIP-seq
MIRT2072765	hsa-miR-15b	CLIP-seq
MIRT2072766	hsa-miR-16	CLIP-seq
MIRT2072767	hsa-miR-1914	CLIP-seq
MIRT2072768	hsa-miR-195	CLIP-seq
MIRT1246451	hsa-miR-3074-5p	CLIP-seq
MIRT1246538	hsa-miR-3125	CLIP-seq
MIRT2072769	hsa-miR-3176	CLIP-seq
MIRT2072770	hsa-miR-3187-5p	CLIP-seq
MIRT2072771	hsa-miR-338-3p	CLIP-seq
MIRT2072772	hsa-miR-3613-3p	CLIP-seq
MIRT2072761	hsa-miR-361-3p	CLIP-seq
MIRT2072773	hsa-miR-3657	CLIP-seq
MIRT2072774	hsa-miR-3670	CLIP-seq
MIRT2072775	hsa-miR-3679-3p	CLIP-seq
MIRT1246463	hsa-miR-3689a-3p	CLIP-seq
MIRT1246464	hsa-miR-3689c	CLIP-seq
MIRT1246465	hsa-miR-370	CLIP-seq
MIRT1246467	hsa-miR-378	CLIP-seq
MIRT1246468	hsa-miR-378b	CLIP-seq
MIRT1246469	hsa-miR-378c	CLIP-seq
MIRT1246470	hsa-miR-378d	CLIP-seq
MIRT1246471	hsa-miR-378e	CLIP-seq
MIRT1246472	hsa-miR-378f	CLIP-seq
MIRT1246473	hsa-miR-378h	CLIP-seq
MIRT1246474	hsa-miR-378i	CLIP-seq
MIRT2072776	hsa-miR-3908	CLIP-seq
MIRT2072777	hsa-miR-3909	CLIP-seq
MIRT1246547	hsa-miR-3916	CLIP-seq
MIRT2072778	hsa-miR-3922-3p	CLIP-seq
MIRT2072779	hsa-miR-3942-5p	CLIP-seq
MIRT2072780	hsa-miR-3944-5p	CLIP-seq
MIRT1246477	hsa-miR-3973	CLIP-seq
MIRT1246478	hsa-miR-422a	CLIP-seq
MIRT2072781	hsa-miR-424	CLIP-seq
MIRT1246479	hsa-miR-4255	CLIP-seq
MIRT2072782	hsa-miR-4269	CLIP-seq
MIRT1246481	hsa-miR-4300	CLIP-seq
MIRT1246483	hsa-miR-4319	CLIP-seq
MIRT1246484	hsa-miR-4324	CLIP-seq
MIRT1246485	hsa-miR-4326	CLIP-seq
MIRT1246488	hsa-miR-4422	CLIP-seq
MIRT2072783	hsa-miR-4436a	CLIP-seq
MIRT2072784	hsa-miR-4444	CLIP-seq
MIRT2072785	hsa-miR-4453	CLIP-seq
MIRT1246490	hsa-miR-4487	CLIP-seq
MIRT2072786	hsa-miR-4530	CLIP-seq
MIRT2072787	hsa-miR-4538	CLIP-seq
MIRT2072788	hsa-miR-4660	CLIP-seq
MIRT2072789	hsa-miR-4663	CLIP-seq
MIRT2072790	hsa-miR-4669	CLIP-seq
MIRT2072791	hsa-miR-4691-5p	CLIP-seq
MIRT2072792	hsa-miR-4703-5p	CLIP-seq
MIRT2072793	hsa-miR-4708-5p	CLIP-seq
MIRT1246501	hsa-miR-4712-5p	CLIP-seq
MIRT2072794	hsa-miR-4757-5p	CLIP-seq
MIRT2072795	hsa-miR-4766-3p	CLIP-seq
MIRT2072796	hsa-miR-4775	CLIP-seq
MIRT2072797	hsa-miR-487a	CLIP-seq
MIRT2072798	hsa-miR-497	CLIP-seq
MIRT1246555	hsa-miR-5047	CLIP-seq
MIRT2072799	hsa-miR-543	CLIP-seq
MIRT2072800	hsa-miR-612	CLIP-seq
MIRT1246522	hsa-miR-628-5p	CLIP-seq
MIRT1246525	hsa-miR-770-5p	CLIP-seq
MIRT1246527	hsa-miR-920	CLIP-seq
MIRT1246424	hsa-miR-1207-3p	CLIP-seq
MIRT1246425	hsa-miR-1208	CLIP-seq
MIRT1246427	hsa-miR-125a-5p	CLIP-seq
MIRT1246428	hsa-miR-125b	CLIP-seq
MIRT2299967	hsa-miR-142-5p	CLIP-seq
MIRT1246433	hsa-miR-145	CLIP-seq
MIRT1246435	hsa-miR-148a	CLIP-seq
MIRT1246436	hsa-miR-148b	CLIP-seq
MIRT1246437	hsa-miR-152	CLIP-seq
MIRT1246438	hsa-miR-154	CLIP-seq
MIRT1246439	hsa-miR-155	CLIP-seq
MIRT1246440	hsa-miR-181a	CLIP-seq
MIRT1246441	hsa-miR-181b	CLIP-seq
MIRT1246442	hsa-miR-181c	CLIP-seq
MIRT1246443	hsa-miR-181d	CLIP-seq
MIRT1246445	hsa-miR-1909	CLIP-seq
MIRT1246446	hsa-miR-198	CLIP-seq
MIRT1246533	hsa-miR-203	CLIP-seq
MIRT2299968	hsa-miR-224	CLIP-seq
MIRT1246534	hsa-miR-28-3p	CLIP-seq
MIRT1246451	hsa-miR-3074-5p	CLIP-seq
MIRT1246536	hsa-miR-3120-5p	CLIP-seq
MIRT1246453	hsa-miR-3143	CLIP-seq
MIRT2299969	hsa-miR-3150a-5p	CLIP-seq
MIRT2299970	hsa-miR-3150b-5p	CLIP-seq
MIRT1246454	hsa-miR-3158-5p	CLIP-seq
MIRT1246457	hsa-miR-3180-5p	CLIP-seq
MIRT1246458	hsa-miR-3187-3p	CLIP-seq
MIRT2299971	hsa-miR-323-3p	CLIP-seq
MIRT1246543	hsa-miR-339-5p	CLIP-seq
MIRT2299972	hsa-miR-340	CLIP-seq
MIRT1246462	hsa-miR-3617	CLIP-seq
MIRT1246465	hsa-miR-370	CLIP-seq
MIRT2299973	hsa-miR-3915	CLIP-seq
MIRT1246476	hsa-miR-3919	CLIP-seq
MIRT2299974	hsa-miR-3928	CLIP-seq
MIRT1246477	hsa-miR-3973	CLIP-seq
MIRT1246479	hsa-miR-4255	CLIP-seq
MIRT1246480	hsa-miR-4262	CLIP-seq
MIRT2072782	hsa-miR-4269	CLIP-seq
MIRT1246549	hsa-miR-4299	CLIP-seq
MIRT1246483	hsa-miR-4319	CLIP-seq
MIRT1246485	hsa-miR-4326	CLIP-seq
MIRT1246486	hsa-miR-4418	CLIP-seq
MIRT1246487	hsa-miR-4421	CLIP-seq
MIRT1246488	hsa-miR-4422	CLIP-seq
MIRT2299975	hsa-miR-4427	CLIP-seq
MIRT1246489	hsa-miR-4435	CLIP-seq
MIRT1246491	hsa-miR-4519	CLIP-seq
MIRT1246493	hsa-miR-4529-5p	CLIP-seq
MIRT2072789	hsa-miR-4663	CLIP-seq
MIRT2299976	hsa-miR-4680-3p	CLIP-seq
MIRT1246499	hsa-miR-4699-3p	CLIP-seq
MIRT1246500	hsa-miR-4701-5p	CLIP-seq
MIRT1246501	hsa-miR-4712-5p	CLIP-seq
MIRT1246502	hsa-miR-4742-3p	CLIP-seq
MIRT1246503	hsa-miR-4803	CLIP-seq
MIRT1246506	hsa-miR-509-5p	CLIP-seq
MIRT1246508	hsa-miR-512-5p	CLIP-seq
MIRT1246509	hsa-miR-520a-5p	CLIP-seq
MIRT1246510	hsa-miR-520g	CLIP-seq
MIRT1246511	hsa-miR-520h	CLIP-seq
MIRT1246512	hsa-miR-525-5p	CLIP-seq
MIRT2072799	hsa-miR-543	CLIP-seq
MIRT1246513	hsa-miR-548ae	CLIP-seq
MIRT1246514	hsa-miR-548aj	CLIP-seq
MIRT1246515	hsa-miR-548am	CLIP-seq
MIRT2299977	hsa-miR-548g	CLIP-seq
MIRT1246516	hsa-miR-548l	CLIP-seq
MIRT1246517	hsa-miR-548s	CLIP-seq
MIRT1246518	hsa-miR-548x	CLIP-seq
MIRT1246519	hsa-miR-567	CLIP-seq
MIRT1246520	hsa-miR-588	CLIP-seq
MIRT2299978	hsa-miR-600	CLIP-seq
MIRT2299979	hsa-miR-616	CLIP-seq
MIRT1246522	hsa-miR-628-5p	CLIP-seq
MIRT2299980	hsa-miR-630	CLIP-seq
MIRT1246524	hsa-miR-641	CLIP-seq
MIRT1246525	hsa-miR-770-5p	CLIP-seq
MIRT1246425	hsa-miR-1208	CLIP-seq
MIRT1246451	hsa-miR-3074-5p	CLIP-seq
MIRT2299971	hsa-miR-323-3p	CLIP-seq
MIRT2072772	hsa-miR-3613-3p	CLIP-seq
MIRT1246465	hsa-miR-370	CLIP-seq
MIRT2072776	hsa-miR-3908	CLIP-seq
MIRT2392782	hsa-miR-3924	CLIP-seq
MIRT2072779	hsa-miR-3942-5p	CLIP-seq
MIRT1246479	hsa-miR-4255	CLIP-seq
MIRT1246485	hsa-miR-4326	CLIP-seq
MIRT1246488	hsa-miR-4422	CLIP-seq
MIRT2072784	hsa-miR-4444	CLIP-seq
MIRT2392783	hsa-miR-4520b-3p	CLIP-seq
MIRT1246499	hsa-miR-4699-3p	CLIP-seq
MIRT2072792	hsa-miR-4703-5p	CLIP-seq
MIRT1246502	hsa-miR-4742-3p	CLIP-seq
MIRT2072795	hsa-miR-4766-3p	CLIP-seq
MIRT2072796	hsa-miR-4775	CLIP-seq
MIRT1246522	hsa-miR-628-5p	CLIP-seq
MIRT2456809	hsa-miR-1276	CLIP-seq
MIRT2456810	hsa-miR-3160-3p	CLIP-seq
MIRT2456811	hsa-miR-3682-3p	CLIP-seq
MIRT2456812	hsa-miR-4502	CLIP-seq
MIRT2456813	hsa-miR-511	CLIP-seq
MIRT2299977	hsa-miR-548g	CLIP-seq
MIRT1246451	hsa-miR-3074-5p	CLIP-seq
MIRT2072775	hsa-miR-3679-3p	CLIP-seq
MIRT2596584	hsa-miR-4446-5p	CLIP-seq
MIRT2688293	hsa-miR-204	CLIP-seq
MIRT2688294	hsa-miR-211	CLIP-seq
MIRT2688295	hsa-miR-2355-5p	CLIP-seq
MIRT1246451	hsa-miR-3074-5p	CLIP-seq
MIRT1246537	hsa-miR-3124-3p	CLIP-seq
MIRT2072775	hsa-miR-3679-3p	CLIP-seq
MIRT2596584	hsa-miR-4446-5p	CLIP-seq
MIRT2688296	hsa-miR-4755-5p	CLIP-seq
MIRT2688297	hsa-miR-623	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
VDR	Unknown	23548800
WT1	Activation	15155752

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IDA	18456258
GO:0001726	Component	Ruffle	IEA
GO:0005515	Function	Protein binding	IPI	22662192, 32296183, 33961781, 35271311
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	18456258
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005886	Component	Plasma membrane	IDA	18456258
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9188463
GO:0005902	Component	Microvillus	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007162	Process	Negative regulation of cell adhesion	ISS
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IEA
GO:0016477	Process	Cell migration	ISS
GO:0022407	Process	Regulation of cell-cell adhesion	IEA
GO:0022408	Process	Negative regulation of cell-cell adhesion	IBA
GO:0022408	Process	Negative regulation of cell-cell adhesion	ISS
GO:0030027	Component	Lamellipodium	IDA	18456258
GO:0030027	Component	Lamellipodium	IEA
GO:0030175	Component	Filopodium	IDA	18456258
GO:0030175	Component	Filopodium	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	18456258
GO:0031528	Component	Microvillus membrane	IBA
GO:0031528	Component	Microvillus membrane	ISS
GO:0032534	Process	Regulation of microvillus assembly	IBA
GO:0032534	Process	Regulation of microvillus assembly	ISS
GO:0033634	Process	Positive regulation of cell-cell adhesion mediated by integrin	IBA
GO:0033634	Process	Positive regulation of cell-cell adhesion mediated by integrin	IDA	18456258
GO:0034451	Component	Centriolar satellite	IDA
GO:0036057	Component	Slit diaphragm	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070062	Component	Extracellular exosome	IDA	15326289
GO:0072015	Process	Podocyte development	ISS
GO:0072175	Process	Epithelial tube formation	ISS

Other IDs

• MIM: 602632
• HGNC: 9171
• e!Ensembl: ENSG00000128567

Protein

• UniProt ID: O00592
• Protein name: Podocalyxin (GCTM-2 antigen) (Gp200) (Podocalyxin-like protein 1) (PC) (PCLP-1)
• Protein function: Involved in the regulation of both adhesion and cell morphology and cancer progression. Functions as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06365	CD34_antigen	358 → 558	CD34/Podocalyxin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Glomerular epithelium cell (podocyte).
• Sequence:

  MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDT
  AQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTI
  ESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT
  PHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVF
  HHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTS
  PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLN
  LTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLP
  AKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAALY
  GCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEKKVVSLNGELGDSWIV
  PLDNLTKDDLDEEEDTHL

• Sequence length: 558

Pathways

KEGG:

Salmonella infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal recessive juvenile Parkinson disease 2	Likely pathogenic	rs1554391082	RCV000210039	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATYPICAL JUVENILE PARKINSONISM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic syndrome	Benign	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson disease, late-onset	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PODXL-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
YOUNG ONSET PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
YOUNG-ONSET PARKINSON DISEASE	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal male sexual function	Abnormal Male Sexual Function	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17137615		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28004467, 30975647		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28004467		★☆☆☆☆ Found in Text Mining only
Akinesia	Akinesia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	18639524		★☆☆☆☆ Found in Text Mining only
Anarthria speech disorder	Anarthria Speech Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26053486		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	33972616	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arterial Diseases, Common Carotid	Moyamoya disease	CTD_human_DG	22016802		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29321582		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	24788963		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29321582		★☆☆☆☆ Found in Text Mining only
Atypical juvenile parkinsonism	Parkinsonian disease	ORPHANET_DG	26864383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atypical juvenile parkinsonism	Parkinsonian disease	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29245936		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31782983		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23288345, 25887862, 26276714		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	8855966	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	8932345	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28946619	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	17970049, 30396958	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15154008	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31782983		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28004467		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26053486	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29321582		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	22016802		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Atherosclerosis	Carotid Atherosclerosis	CTD_human_DG	22016802		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	17137615		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28946619		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17719804		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22769594, 30277651, 30575907		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21829192, 22769594, 23443137, 23819542, 24668684, 25004863, 25004935, 27160084, 28946619, 30277651, 30575907, 32587323, 34440856	Associate	★☆☆☆☆ Found in Text Mining only
Dementia of frontal lobe type	Dementia Of Frontal Lobe	HPO_DG			★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29321582		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29321582		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31097305		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	21655212, 32337271, 35637650	Associate	★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29321582		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	25923336	Associate	★☆☆☆☆ Found in Text Mining only
External Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	22016802		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	30898510		★☆☆☆☆ Found in Text Mining only
Female sexual dysfunction	Female sexual dysfunction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	24048372, 24154691, 30737302		★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18639524, 25349993, 25708368		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24146797, 25349993	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25349993, 25708368		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24146797	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	19875807, 22578955	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	22679920	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	31352863	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	15509792		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	17229675, 33780168, 40282423	Associate	★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29245936		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	8855966	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29321582		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	31352863		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Internal Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	22016802		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	31321677		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17062753, 29476712, 31097305		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	33780168	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	15509792, 30737302		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22374871	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28004467	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28757276, 29050536		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	28757276	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23819542	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28432273		★☆☆☆☆ Found in Text Mining only
Male sexual dysfunction	Male sexual dysfunction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23288345, 25887862, 26276714		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28004467		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29588598, 30975647		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16434482, 28408238, 30396958		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16434482		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26674770, 28432273		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	21383689		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31782983		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17124010, 18639524, 20599725, 21383689, 24788963, 26276714, 26796961, 27461278, 28004467, 28946619, 29245936, 31083655, 31669641		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28946619		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15289306		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25887862, 26796961, 29245936		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31622599		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31622599	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	31083655		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33800494	Associate	★☆☆☆☆ Found in Text Mining only
MILES-CARPENTER X-LINKED MENTAL RETARDATION SYNDROME	MILES-CARPENTER X-Linked MENTAL RETARDATION SYNDROME	BEFREE	31097305		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16434482, 18639524, 21383689, 22769594, 23288345, 25887862, 26796961, 28004467, 30575907		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	8600307		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	15155752, 19955187, 27960539, 31352863		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	31321677		★☆☆☆☆ Found in Text Mining only
Nephrosis, congenital	Nephrosis, Congenital	GENOMICS_ENGLAND_DG	24048372, 28117080		★☆☆☆☆ Found in Text Mining only
Nephrosis, congenital	Nephrosis, Congenital	BEFREE	29244787		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	GENOMICS_ENGLAND_DG	30523047		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	33780168	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20628624	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29588598, 30975647		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26053486		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27461278, 32587323, 33972616, 35275973	Associate	★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31564376		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	BEFREE	26864383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	CLINVAR_DG	26864383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	31097305		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	31097305		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	31117091		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16434482, 30396958		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16434482		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16434482		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	30396958		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30396958	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	17229675, 28757276	Associate	★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	27435507, 29321582, 29976076, 8600307		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30737302		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	34667143	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	17970049		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	17970049	Associate	★☆☆☆☆ Found in Text Mining only
Social Communication Disorder	Social Communication Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25915207	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	25915207		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26674770, 28432273		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26674770, 30355278	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23652315, 8595155	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	29604348		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	15155752	Associate	★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	31564376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Young-onset Parkinson disease	Parkinson disease	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations