Gene Gene information from NCBI Gene database.
Entrez ID 54165
Gene name Defective in cullin neddylation 1 domain containing 1
Gene symbol DCUN1D1
Synonyms (NCBI Gene)
DCNL1DCUN1L1RP42SCCROSCROTes3
Chromosome 3
Chromosome location 3q26.33
miRNA miRNA information provided by mirtarbase database.
533
miRTarBase ID miRNA Experiments Reference
MIRT023689 hsa-miR-1-3p Proteomics 18668040
MIRT023689 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT044328 hsa-miR-106b-5p CLASH 23622248
MIRT558470 hsa-miR-6835-3p PAR-CLIP 21572407
MIRT558469 hsa-miR-30a-5p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IBA
GO:0000151 Component Ubiquitin ligase complex IDA 18826954
GO:0005515 Function Protein binding IPI 16189514, 18826954, 19617556, 21145461, 23401859, 25416956, 26906416, 27107012, 28514442, 28581483, 30587576, 32296183, 33961781
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus IMP 26906416
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605905 18184 ENSG00000043093
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96GG9
Protein name DCN1-like protein 1 (DCNL1) (DCUN1 domain-containing protein 1) (Defective in cullin neddylation protein 1-like protein 1) (Squamous cell carcinoma-related oncogene)
Protein function Part of an E3 ubiquitin ligase complex for neddylation (PubMed:18826954). Promotes neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes (PubMed:19617556, PubMed:23201271, PubMed:23401859, PubMed:26906416). Acts by bindin
PDB 3TDU , 3TDZ , 4P5O , 5UFI , 5V83 , 5V86 , 5V88 , 6B5Q , 6BG3 , 6BG5 , 6P5V , 6P5W , 6XOL , 6XOM , 6XON , 6XOO , 6XOP , 6XOQ , 7KWA , 8OR2 , 8OR3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14555 UBA_4 9 50 Domain
PF03556 Cullin_binding 136 246 Cullin binding Family
Tissue specificity TISSUE SPECIFICITY: Expressed in pancreas, kidney, placenta, brain and heart. Weakly or not expressed in liver, skeletal muscle and lung. Strongly overexpressed in thyroid tumors, bronchioloalveolar carcinomas, and malignant tissues of squamous cell carci
Sequence
MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSL
DRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQ
EFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIA
YWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLI
DDFVEF
ARPQIAGTKSTTV
Sequence length 259
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PARKINSON DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 15511464
★☆☆☆☆
Found in Text Mining only
Adrenal Cortical Adenoma Adrenocortical adenoma BEFREE 15657565
★☆☆☆☆
Found in Text Mining only
Adrenocortical carcinoma Adrenocortical carcinoma BEFREE 15657565
★☆☆☆☆
Found in Text Mining only
Adrenocortical carcinoma Adrenocortical carcinoma LHGDN 15657565
★☆☆☆☆
Found in Text Mining only
Agenesis of corpus callosum Agenesis Of Corpus Callosum BEFREE 15657565
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 16987882
★☆☆☆☆
Found in Text Mining only
Anaplasia Anaplasia BEFREE 15657565
★☆☆☆☆
Found in Text Mining only
Aplasia Cutis Congenita Aplasia Cutis Congenita BEFREE 15657565
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism BEFREE 10777668
★☆☆☆☆
Found in Text Mining only
Bronchioloalveolar Adenocarcinoma Lung adenocarcinoma BEFREE 15511464
★☆☆☆☆
Found in Text Mining only