Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5411
Gene name	Pinin, desmosome associated protein
Gene symbol	PNN
Synonyms (NCBI Gene)	DRSDRSPSDK3memA
Chromosome	14
Chromosome location	14q21.1

178

Show/Hide all (178)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000894	hsa-miR-15a-5p	Microarray	18362358
MIRT000893	hsa-miR-16-5p	Microarray	18362358
MIRT016172	hsa-miR-590-3p	Sequencing	20371350
MIRT023423	hsa-miR-30b-5p	Sequencing	20371350
MIRT023477	hsa-miR-23b-3p	Sequencing	20371350
MIRT023760	hsa-miR-1-3p	Proteomics	18668040
MIRT044620	hsa-miR-320a	CLASH	23622248
MIRT036922	hsa-miR-877-3p	CLASH	23622248
MIRT547050	hsa-miR-4724-5p	PAR-CLIP	21572407
MIRT547049	hsa-miR-550b-3p	PAR-CLIP	21572407
MIRT069997	hsa-miR-4709-3p	PAR-CLIP	21572407
MIRT114488	hsa-miR-548e-5p	PAR-CLIP	22012620
MIRT114493	hsa-miR-3662	PAR-CLIP	22012620
MIRT532582	hsa-miR-4311	PAR-CLIP	22012620
MIRT532581	hsa-miR-1276	PAR-CLIP	22012620
MIRT114484	hsa-miR-583	PAR-CLIP	22012620
MIRT044620	hsa-miR-320a	PAR-CLIP	22012620
MIRT114485	hsa-miR-320b	PAR-CLIP	22012620
MIRT114486	hsa-miR-320c	PAR-CLIP	22012620
MIRT114490	hsa-miR-320d	PAR-CLIP	22012620
MIRT114496	hsa-miR-4429	PAR-CLIP	22012620
MIRT114487	hsa-miR-1185-5p	PAR-CLIP	22012620
MIRT114494	hsa-miR-3679-5p	PAR-CLIP	22012620
MIRT069995	hsa-miR-3145-3p	PAR-CLIP	22012620
MIRT442667	hsa-miR-873-5p	PAR-CLIP	22100165
MIRT442665	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT547050	hsa-miR-4724-5p	PAR-CLIP	21572407
MIRT547049	hsa-miR-550b-3p	PAR-CLIP	21572407
MIRT069997	hsa-miR-4709-3p	PAR-CLIP	21572407
MIRT114488	hsa-miR-548e-5p	PAR-CLIP	22012620
MIRT114493	hsa-miR-3662	PAR-CLIP	22012620
MIRT532582	hsa-miR-4311	PAR-CLIP	22012620
MIRT532581	hsa-miR-1276	PAR-CLIP	22012620
MIRT114484	hsa-miR-583	PAR-CLIP	22012620
MIRT044620	hsa-miR-320a	PAR-CLIP	22012620
MIRT114485	hsa-miR-320b	PAR-CLIP	22012620
MIRT114486	hsa-miR-320c	PAR-CLIP	22012620
MIRT114490	hsa-miR-320d	PAR-CLIP	22012620
MIRT114496	hsa-miR-4429	PAR-CLIP	22012620
MIRT114487	hsa-miR-1185-5p	PAR-CLIP	22012620
MIRT114494	hsa-miR-3679-5p	PAR-CLIP	22012620
MIRT069995	hsa-miR-3145-3p	PAR-CLIP	22012620
MIRT442667	hsa-miR-873-5p	PAR-CLIP	22100165
MIRT442665	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT1245173	hsa-miR-1231	CLIP-seq
MIRT1245174	hsa-miR-1263	CLIP-seq
MIRT1245175	hsa-miR-1283	CLIP-seq
MIRT1245176	hsa-miR-132	CLIP-seq
MIRT1245177	hsa-miR-147	CLIP-seq
MIRT1245178	hsa-miR-186	CLIP-seq
MIRT1245179	hsa-miR-205	CLIP-seq
MIRT1245180	hsa-miR-2053	CLIP-seq
MIRT1245181	hsa-miR-2113	CLIP-seq
MIRT1245182	hsa-miR-212	CLIP-seq
MIRT1245183	hsa-miR-30a	CLIP-seq
MIRT1245184	hsa-miR-30b	CLIP-seq
MIRT1245185	hsa-miR-30c	CLIP-seq
MIRT1245186	hsa-miR-30d	CLIP-seq
MIRT1245187	hsa-miR-30e	CLIP-seq
MIRT1245188	hsa-miR-3138	CLIP-seq
MIRT1245189	hsa-miR-3152-3p	CLIP-seq
MIRT1245190	hsa-miR-3161	CLIP-seq
MIRT1245191	hsa-miR-338-5p	CLIP-seq
MIRT1245192	hsa-miR-34b	CLIP-seq
MIRT1245193	hsa-miR-3613-3p	CLIP-seq
MIRT1245194	hsa-miR-3614-5p	CLIP-seq
MIRT1245195	hsa-miR-3660	CLIP-seq
MIRT1245196	hsa-miR-3908	CLIP-seq
MIRT1245197	hsa-miR-4490	CLIP-seq
MIRT1245198	hsa-miR-4496	CLIP-seq
MIRT1245199	hsa-miR-4526	CLIP-seq
MIRT1245200	hsa-miR-4635	CLIP-seq
MIRT1245201	hsa-miR-4666-3p	CLIP-seq
MIRT1245202	hsa-miR-4729	CLIP-seq
MIRT1245203	hsa-miR-4742-3p	CLIP-seq
MIRT1245204	hsa-miR-4752	CLIP-seq
MIRT1245205	hsa-miR-4774-5p	CLIP-seq
MIRT1245206	hsa-miR-4775	CLIP-seq
MIRT1245207	hsa-miR-4795-3p	CLIP-seq
MIRT1245208	hsa-miR-4800-5p	CLIP-seq
MIRT1245209	hsa-miR-487a	CLIP-seq
MIRT1245210	hsa-miR-491-3p	CLIP-seq
MIRT1245211	hsa-miR-495	CLIP-seq
MIRT1245212	hsa-miR-507	CLIP-seq
MIRT1245213	hsa-miR-526b	CLIP-seq
MIRT1245214	hsa-miR-543	CLIP-seq
MIRT1245215	hsa-miR-548a-3p	CLIP-seq
MIRT1245216	hsa-miR-548aa	CLIP-seq
MIRT1245217	hsa-miR-548ac	CLIP-seq
MIRT1245218	hsa-miR-548ad	CLIP-seq
MIRT1245219	hsa-miR-548ae	CLIP-seq
MIRT1245220	hsa-miR-548aj	CLIP-seq
MIRT1245221	hsa-miR-548am	CLIP-seq
MIRT1245222	hsa-miR-548d-3p	CLIP-seq
MIRT1245223	hsa-miR-548e	CLIP-seq
MIRT1245224	hsa-miR-548f	CLIP-seq
MIRT1245225	hsa-miR-548g	CLIP-seq
MIRT1245226	hsa-miR-548k	CLIP-seq
MIRT1245227	hsa-miR-548n	CLIP-seq
MIRT1245228	hsa-miR-548x	CLIP-seq
MIRT1245229	hsa-miR-548z	CLIP-seq
MIRT1245230	hsa-miR-549	CLIP-seq
MIRT1245231	hsa-miR-557	CLIP-seq
MIRT1245232	hsa-miR-569	CLIP-seq
MIRT1245233	hsa-miR-570	CLIP-seq
MIRT1245234	hsa-miR-576-5p	CLIP-seq
MIRT1245235	hsa-miR-579	CLIP-seq
MIRT1245236	hsa-miR-581	CLIP-seq
MIRT1245237	hsa-miR-587	CLIP-seq
MIRT1245238	hsa-miR-617	CLIP-seq
MIRT1245239	hsa-miR-622	CLIP-seq
MIRT1245240	hsa-miR-873	CLIP-seq
MIRT1245201	hsa-miR-4666-3p	CLIP-seq
MIRT2072555	hsa-miR-1208	CLIP-seq
MIRT1245179	hsa-miR-205	CLIP-seq
MIRT1245181	hsa-miR-2113	CLIP-seq
MIRT2072556	hsa-miR-23a	CLIP-seq
MIRT2072557	hsa-miR-23b	CLIP-seq
MIRT2072558	hsa-miR-23c	CLIP-seq
MIRT2072559	hsa-miR-300	CLIP-seq
MIRT1245188	hsa-miR-3138	CLIP-seq
MIRT2072560	hsa-miR-3682-5p	CLIP-seq
MIRT2072561	hsa-miR-381	CLIP-seq
MIRT2072562	hsa-miR-412	CLIP-seq
MIRT2072563	hsa-miR-4420	CLIP-seq
MIRT1245204	hsa-miR-4752	CLIP-seq
MIRT2072564	hsa-miR-4778-3p	CLIP-seq
MIRT1245207	hsa-miR-4795-3p	CLIP-seq
MIRT1245208	hsa-miR-4800-5p	CLIP-seq
MIRT2072565	hsa-miR-5096	CLIP-seq
MIRT1245235	hsa-miR-579	CLIP-seq
MIRT1245178	hsa-miR-186	CLIP-seq
MIRT1245179	hsa-miR-205	CLIP-seq
MIRT1245181	hsa-miR-2113	CLIP-seq
MIRT2072559	hsa-miR-300	CLIP-seq
MIRT1245188	hsa-miR-3138	CLIP-seq
MIRT2299667	hsa-miR-3182	CLIP-seq
MIRT1245191	hsa-miR-338-5p	CLIP-seq
MIRT1245192	hsa-miR-34b	CLIP-seq
MIRT2299668	hsa-miR-377	CLIP-seq
MIRT2072561	hsa-miR-381	CLIP-seq
MIRT2299669	hsa-miR-3922-5p	CLIP-seq
MIRT2299670	hsa-miR-3926	CLIP-seq
MIRT2299671	hsa-miR-3973	CLIP-seq
MIRT2299672	hsa-miR-4274	CLIP-seq
MIRT2299673	hsa-miR-452	CLIP-seq
MIRT1245201	hsa-miR-4666-3p	CLIP-seq
MIRT2299674	hsa-miR-4676-3p	CLIP-seq
MIRT2299675	hsa-miR-4704-3p	CLIP-seq
MIRT1245202	hsa-miR-4729	CLIP-seq
MIRT2299676	hsa-miR-4731-3p	CLIP-seq
MIRT1245204	hsa-miR-4752	CLIP-seq
MIRT2072564	hsa-miR-4778-3p	CLIP-seq
MIRT1245207	hsa-miR-4795-3p	CLIP-seq
MIRT1245208	hsa-miR-4800-5p	CLIP-seq
MIRT2299677	hsa-miR-4801	CLIP-seq
MIRT1245209	hsa-miR-487a	CLIP-seq
MIRT1245212	hsa-miR-507	CLIP-seq
MIRT2299678	hsa-miR-518a-5p	CLIP-seq
MIRT2299679	hsa-miR-520g	CLIP-seq
MIRT2299680	hsa-miR-520h	CLIP-seq
MIRT2299681	hsa-miR-527	CLIP-seq
MIRT2299682	hsa-miR-548s	CLIP-seq
MIRT1245231	hsa-miR-557	CLIP-seq
MIRT1245235	hsa-miR-579	CLIP-seq
MIRT1245237	hsa-miR-587	CLIP-seq
MIRT1245238	hsa-miR-617	CLIP-seq
MIRT1245240	hsa-miR-873	CLIP-seq
MIRT2072555	hsa-miR-1208	CLIP-seq
MIRT2072556	hsa-miR-23a	CLIP-seq
MIRT2072557	hsa-miR-23b	CLIP-seq
MIRT2072558	hsa-miR-23c	CLIP-seq
MIRT2072560	hsa-miR-3682-5p	CLIP-seq
MIRT2072562	hsa-miR-412	CLIP-seq
MIRT2072563	hsa-miR-4420	CLIP-seq
MIRT2072564	hsa-miR-4778-3p	CLIP-seq
MIRT2072565	hsa-miR-5096	CLIP-seq
MIRT1245207	hsa-miR-4795-3p	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	IC	11991638
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005198	Function	Structural molecule activity	NAS	8922384
GO:0005515	Function	Protein binding	IPI	17332742, 18794151, 20467437, 22113938, 22388736, 28514442, 30021884, 32296183, 32707033, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005882	Component	Intermediate filament	TAS	10809736
GO:0005886	Component	Plasma membrane	TAS	8922384
GO:0005911	Component	Cell-cell junction	TAS	8922384
GO:0006397	Process	MRNA processing	IEA
GO:0007155	Process	Cell adhesion	TAS	8922384
GO:0008380	Process	RNA splicing	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016607	Component	Nuclear speck	IDA
GO:0016607	Component	Nuclear speck	IEA
GO:0030057	Component	Desmosome	IEA
GO:0035145	Component	Exon-exon junction complex	IDA	16314458
GO:0070161	Component	Anchoring junction	IEA
GO:0071013	Component	Catalytic step 2 spliceosome	IBA
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638

MIM	HGNC	e!Ensembl
603154	9162	ENSG00000100941

Q9H307

Protein name

Pinin (140 kDa nuclear and cell adhesion-related phosphoprotein) (Desmosome-associated protein) (Domain-rich serine protein) (DRS protein) (DRSP) (Melanoma metastasis clone A protein) (Nuclear protein SDK3) (SR-like protein)

Protein function

Transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. Capable of reversing CTBP1-mediated transcription repression. Auxiliary component of the splicing-dependent

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04697	Pinin_SDK_N	1 → 132	pinin/SDK conserved region	Family
PF04696	Pinin_SDK_memA	136 → 261	pinin/SDK/memA/ protein conserved region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, epidermis, esophagus, brain and smooth and skeletal muscle. Expressed strongly in melanoma metastasis lesions

Sequence

MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLL
LRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATS
KERTRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQ
AEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPH
LFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN
EEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAEKEQEEEEQKQ
EMEVKMEEETEVRESEKQQDSQPEEVMDVLEMVENVKHVIADQEVMETNRVESVEPSENE
ASKELEPEMEFEIEPDKECKTLSPGKENVSALDMEKESEEKEEKESEPQPEPVAQPQPQS
QPQLQLQSQSQPVLQSQPPSQPEDLSLAVLQPTPQVTQEQGHLLPERKDFPVESVKLTEV
PVEPVLTVHPESKSKTKTRSRSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSSSSGS
SSSRSSSSSSSSTSGSSSRDSSSSTSSSSESRSRSRGRGHNRDRKHRRSVDRKRRDTSGL
ERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKRSSRSERDRKSDRKDKRR

Sequence length

717

Interactions

View interactions

	KEGG
	Nucleocytoplasmic transport mRNA surveillance pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (55)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	3031662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	24331455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	24331455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	37814309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19797135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28546501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18086895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27175589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33811436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33070392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35257416, 35996844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	12716466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33208224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	25310850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25310850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28397705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	31415467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	19269948, 27917740, 28116342, 28243098, 28262089, 28275701, 28280733, 28903799, 29966197, 30032141, 30045679, 30200896, 30664239, 30782151, 31376870, 31535614, 31801901 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28116342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	24331455, 30072308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	35257416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	28275701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30022635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28064076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	28546501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	3600768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism, Isolated Hypogonadotropic	Hypogonadism	BEFREE	11397871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36265170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35257416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30990571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31167655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	3031662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27175589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30022635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10861446, 12874760, 26871283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	24331455, 30072308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28262089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30990571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	24309110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10490811, 12716466, 18521630, 28797092, 29196338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	19424611		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	29704656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26871283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	28797092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30940512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31376870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	3031662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28116342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	12874760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	33070392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	28275701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	19424611, 26008974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26008974	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28397705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	28546501		★★★★★ ★☆☆☆☆ Found in Text Mining only

PNN (pinin, desmosome associated protein)