Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	54102
Gene name	Chloride intracellular channel 6
Gene symbol	CLIC6
Synonyms (NCBI Gene)	CLIC1L
Chromosome	21
Chromosome location	21q22.12
Summary	This gene encodes a member of the chloride intracellular channel family of proteins. The gene is part of a large triplicated region found on chromosomes 1, 6, and 21. Alternative splicing results in multiple transcript variants encoding different isoforms

Show/Hide all (80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT646342	hsa-miR-383-5p	HITS-CLIP	23824327
MIRT646341	hsa-miR-1288-5p	HITS-CLIP	23824327
MIRT646340	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT646339	hsa-miR-5702	HITS-CLIP	23824327
MIRT646338	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT646337	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT646336	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT646335	hsa-miR-8081	HITS-CLIP	23824327
MIRT646334	hsa-miR-8055	HITS-CLIP	23824327
MIRT608889	hsa-miR-6758-5p	HITS-CLIP	24906430
MIRT608888	hsa-miR-6856-5p	HITS-CLIP	24906430
MIRT608887	hsa-miR-3976	HITS-CLIP	24906430
MIRT608886	hsa-miR-3689a-5p	HITS-CLIP	24906430
MIRT608885	hsa-miR-3689b-5p	HITS-CLIP	24906430
MIRT608884	hsa-miR-3689e	HITS-CLIP	24906430
MIRT608883	hsa-miR-3689f	HITS-CLIP	24906430
MIRT608882	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608881	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT608880	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT608886	hsa-miR-3689a-5p	HITS-CLIP	27418678
MIRT608885	hsa-miR-3689b-5p	HITS-CLIP	27418678
MIRT608884	hsa-miR-3689e	HITS-CLIP	27418678
MIRT608883	hsa-miR-3689f	HITS-CLIP	27418678
MIRT608887	hsa-miR-3976	HITS-CLIP	27418678
MIRT608880	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608889	hsa-miR-6758-5p	HITS-CLIP	27418678
MIRT608881	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608888	hsa-miR-6856-5p	HITS-CLIP	27418678
MIRT608882	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT646342	hsa-miR-383-5p	HITS-CLIP	23824327
MIRT646341	hsa-miR-1288-5p	HITS-CLIP	23824327
MIRT646340	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT646339	hsa-miR-5702	HITS-CLIP	23824327
MIRT646338	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT646337	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT646336	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT646335	hsa-miR-8081	HITS-CLIP	23824327
MIRT646334	hsa-miR-8055	HITS-CLIP	23824327
MIRT1965781	hsa-miR-147	CLIP-seq
MIRT1965782	hsa-miR-3612	CLIP-seq
MIRT1965783	hsa-miR-3689b	CLIP-seq
MIRT1965784	hsa-miR-4443	CLIP-seq
MIRT1965785	hsa-miR-650	CLIP-seq
MIRT2201723	hsa-miR-124	CLIP-seq
MIRT1965781	hsa-miR-147	CLIP-seq
MIRT2201724	hsa-miR-320e	CLIP-seq
MIRT1965783	hsa-miR-3689b	CLIP-seq
MIRT2201725	hsa-miR-4699-5p	CLIP-seq
MIRT2201726	hsa-miR-4724-5p	CLIP-seq
MIRT2201727	hsa-miR-506	CLIP-seq
MIRT2504641	hsa-miR-103a	CLIP-seq
MIRT2504642	hsa-miR-107	CLIP-seq
MIRT2504643	hsa-miR-1184	CLIP-seq
MIRT2504644	hsa-miR-4274	CLIP-seq
MIRT2504645	hsa-miR-4418	CLIP-seq
MIRT2504646	hsa-miR-4731-5p	CLIP-seq
MIRT2504647	hsa-miR-509-3-5p	CLIP-seq
MIRT2504648	hsa-miR-509-5p	CLIP-seq
MIRT2504649	hsa-miR-548a-3p	CLIP-seq
MIRT2504650	hsa-miR-548e	CLIP-seq
MIRT2504651	hsa-miR-548f	CLIP-seq
MIRT2504641	hsa-miR-103a	CLIP-seq
MIRT2504642	hsa-miR-107	CLIP-seq
MIRT2504643	hsa-miR-1184	CLIP-seq
MIRT2678286	hsa-miR-1915	CLIP-seq
MIRT2504644	hsa-miR-4274	CLIP-seq
MIRT2678287	hsa-miR-4305	CLIP-seq
MIRT2504645	hsa-miR-4418	CLIP-seq
MIRT2678288	hsa-miR-4717-5p	CLIP-seq
MIRT2678289	hsa-miR-4726-3p	CLIP-seq
MIRT2504646	hsa-miR-4731-5p	CLIP-seq
MIRT2504647	hsa-miR-509-3-5p	CLIP-seq
MIRT2504648	hsa-miR-509-5p	CLIP-seq
MIRT2678290	hsa-miR-5096	CLIP-seq
MIRT2678291	hsa-miR-515-5p	CLIP-seq
MIRT2504649	hsa-miR-548a-3p	CLIP-seq
MIRT2504650	hsa-miR-548e	CLIP-seq
MIRT2504651	hsa-miR-548f	CLIP-seq
MIRT2678292	hsa-miR-548u	CLIP-seq
MIRT2678293	hsa-miR-583	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005254	Function	Chloride channel activity	IDA	37838179
GO:0005254	Function	Chloride channel activity	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0031749	Function	D2 dopamine receptor binding	IBA
GO:0031750	Function	D3 dopamine receptor binding	IBA
GO:0031751	Function	D4 dopamine receptor binding	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1902476	Process	Chloride transmembrane transport	IEA

MIM	HGNC	e!Ensembl
615321	2065	ENSG00000159212

Q96NY7

Protein name

Chloride intracellular channel protein 6 (Glutaredoxin-like oxidoreductase CLIC6) (EC 1.8.-.-) (Parchorin)

Protein function

In the soluble state, catalyzes glutaredoxin-like thiol disulfide exchange reactions with reduced glutathione as electron donor (By similarity). Can insert into membranes and form voltage-dependent chloride-selective channels. The channel opens

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13410	GST_C_2	585 → 675		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, placenta, pancreas, liver, lung, heart, kidney, liver, spleen, soleus muscle, and brown fat. {ECO:0000269|PubMed:12226712, ECO:0000269|PubMed:37838179}.

Sequence

MAEAAEPEGVAPGPQGPPEVPAPLAERPGEPGAAGGEAEGPEGSEGAEEAPRGAAAVKEA
GGGGPDRGPEAEARGTRGAHGETEAEEGAPEGAEVPQGGEETSGAQQVEGASPGRGAQGE
PRGEAQREPEDSAAPERQEEAEQRPEVPEGSASGEAGDSVDAEGPLGDNIEAEGPAGDSV
EAEGRVGDSVDAEGPAGDSVDAEGPLGDNIQAEGPAGDSVDAEGRVGDSVDAEGPAGDSV
DAEGRVGDSVEAGDPAGDGVEAGVPAGDSVEAEGPAGDSMDAEGPAGRARRVSGEPQQSG
DGSLSPQAEAIEVAAGESAGRSPGELAWDAAEEAEVPGVKGSEEAAPGDARADAGEDRVG
DGPQQEPGEDEERRERSPEGPREEEAAGGEEESPDSSPHGEASRGAAEPEAQLSNHLAEE
GPAEGSGEAARVNGRREDGEASEPRALGQEHDITLFVKVKLTALGCSRIAIKKYLRAGYD
GESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDV
NKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIHEKNLLKAL
RKLDNYLNSPLPDEIDAYSTEDVTVSGRKFLDGDELTLADCNLLPKLHIIKIVAKKYRDF
EFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAYSDVAKRMK

Sequence length

704

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Myoepithelial tumor	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
sellar metastasis from primary bronchial carcinoid tumor	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	34697589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31757997, 39512680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39966932	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34766585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	34697589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36915125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34840985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CLIC6 (chloride intracellular channel 6)