RIPK4 (receptor interacting serine/threonine kinase 4)

Gene

• Entrez ID: 54101
• Gene name: Receptor interacting serine/threonine kinase 4
• Gene symbol: RIPK4
• Synonyms (NCBI Gene): ANKK2, ANKRD3, CHANDS, DIK, NKRD3, PKK, PPS2, RIP4
• Chromosome: 21
• Chromosome location: 21q22.3
• Summary: The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. [

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022302	hsa-miR-124-3p	Microarray	18668037
MIRT029009	hsa-miR-26b-5p	Microarray	19088304
MIRT563830	hsa-miR-548an	PAR-CLIP	20371350
MIRT563829	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT563828	hsa-miR-4484	PAR-CLIP	20371350
MIRT022302	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT563827	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT563826	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT563825	hsa-miR-5003-5p	PAR-CLIP	20371350
MIRT563824	hsa-miR-545-5p	PAR-CLIP	20371350
MIRT563823	hsa-miR-1827	PAR-CLIP	20371350
MIRT563830	hsa-miR-548an	PAR-CLIP	20371350
MIRT563829	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT563828	hsa-miR-4484	PAR-CLIP	20371350
MIRT022302	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT563827	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT563826	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT563825	hsa-miR-5003-5p	PAR-CLIP	20371350
MIRT563824	hsa-miR-545-5p	PAR-CLIP	20371350
MIRT563823	hsa-miR-1827	PAR-CLIP	20371350
MIRT1307636	hsa-miR-1324	CLIP-seq
MIRT1307637	hsa-miR-214	CLIP-seq
MIRT1307638	hsa-miR-3135	CLIP-seq
MIRT1307639	hsa-miR-3161	CLIP-seq
MIRT1307640	hsa-miR-3619-5p	CLIP-seq
MIRT1307641	hsa-miR-3665	CLIP-seq
MIRT1307642	hsa-miR-4678	CLIP-seq
MIRT1307643	hsa-miR-4746-5p	CLIP-seq
MIRT1307644	hsa-miR-548ag	CLIP-seq
MIRT1307645	hsa-miR-548ai	CLIP-seq
MIRT1307646	hsa-miR-664	CLIP-seq
MIRT1307647	hsa-miR-761	CLIP-seq
MIRT1307648	hsa-miR-764	CLIP-seq
MIRT2091170	hsa-miR-124	CLIP-seq
MIRT2091171	hsa-miR-506	CLIP-seq
MIRT2315925	hsa-miR-105	CLIP-seq
MIRT2091170	hsa-miR-124	CLIP-seq
MIRT2315926	hsa-miR-125a-3p	CLIP-seq
MIRT2315927	hsa-miR-1302	CLIP-seq
MIRT1307636	hsa-miR-1324	CLIP-seq
MIRT2315928	hsa-miR-208a	CLIP-seq
MIRT2315929	hsa-miR-208b	CLIP-seq
MIRT1307637	hsa-miR-214	CLIP-seq
MIRT2315930	hsa-miR-23a	CLIP-seq
MIRT2315931	hsa-miR-23b	CLIP-seq
MIRT2315932	hsa-miR-23c	CLIP-seq
MIRT2315933	hsa-miR-28-5p	CLIP-seq
MIRT1307638	hsa-miR-3135	CLIP-seq
MIRT2315934	hsa-miR-3139	CLIP-seq
MIRT2315935	hsa-miR-3143	CLIP-seq
MIRT2315936	hsa-miR-3145-3p	CLIP-seq
MIRT2315937	hsa-miR-3183	CLIP-seq
MIRT2315938	hsa-miR-3617	CLIP-seq
MIRT1307640	hsa-miR-3619-5p	CLIP-seq
MIRT2315939	hsa-miR-3658	CLIP-seq
MIRT1307641	hsa-miR-3665	CLIP-seq
MIRT2315940	hsa-miR-3913-3p	CLIP-seq
MIRT2315941	hsa-miR-4266	CLIP-seq
MIRT2315942	hsa-miR-4298	CLIP-seq
MIRT2315943	hsa-miR-455-3p	CLIP-seq
MIRT2315944	hsa-miR-4645-3p	CLIP-seq
MIRT2315945	hsa-miR-4650-5p	CLIP-seq
MIRT2315946	hsa-miR-4670-3p	CLIP-seq
MIRT2315947	hsa-miR-4670-5p	CLIP-seq
MIRT2315948	hsa-miR-4723-3p	CLIP-seq
MIRT2315949	hsa-miR-4757-5p	CLIP-seq
MIRT2315950	hsa-miR-4786-5p	CLIP-seq
MIRT2315951	hsa-miR-4803	CLIP-seq
MIRT2315952	hsa-miR-489	CLIP-seq
MIRT2315953	hsa-miR-498	CLIP-seq
MIRT2315954	hsa-miR-499-5p	CLIP-seq
MIRT2091171	hsa-miR-506	CLIP-seq
MIRT2315955	hsa-miR-542-3p	CLIP-seq
MIRT2315956	hsa-miR-551a	CLIP-seq
MIRT2315957	hsa-miR-551b	CLIP-seq
MIRT2315958	hsa-miR-552	CLIP-seq
MIRT2315959	hsa-miR-641	CLIP-seq
MIRT2315960	hsa-miR-660	CLIP-seq
MIRT2315961	hsa-miR-708	CLIP-seq
MIRT1307647	hsa-miR-761	CLIP-seq
MIRT1307648	hsa-miR-764	CLIP-seq
MIRT2432753	hsa-miR-3163	CLIP-seq
MIRT2432754	hsa-miR-340	CLIP-seq
MIRT2432755	hsa-miR-3688-3p	CLIP-seq
MIRT2432756	hsa-miR-4261	CLIP-seq
MIRT2689778	hsa-miR-1976	CLIP-seq
MIRT2689779	hsa-miR-3130-3p	CLIP-seq
MIRT2689780	hsa-miR-4279	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002009	Process	Morphogenesis of an epithelium	IMP	22197488
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	21931591, 23371553, 26972000, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0043588	Process	Skin development	IEA
GO:0043588	Process	Skin development	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	21931591
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106310	Function	Protein serine kinase activity	ISS

Other IDs

• MIM: 605706
• HGNC: 496
• e!Ensembl: ENSG00000183421

Protein

• UniProt ID: P57078
• Protein name: Receptor-interacting serine/threonine-protein kinase 4 (EC 2.7.11.1) (Ankyrin repeat domain-containing protein 3) (PKC-delta-interacting protein kinase)
• Protein function: Serine/threonine protein kinase (By similarity). Required for embryonic skin development and correct skin homeostasis in adults, via phosphorylation of PKP1 and subsequent promotion of keratinocyte differentiation and cell adhesion (By similarit
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	22 → 282	Protein kinase domain	Domain
  PF12796	Ank_2	458 → 549	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	532 → 615	Ankyrin repeats (3 copies)	Repeat
  PF13637	Ank_4	618 → 672		Repeat
  PF12796	Ank_2	674 → 748	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	745 → 813	Ankyrin repeats (3 copies)	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Expressed in hair follicles and skin. {ECO:0000269|PubMed:26129644}.
• Sequence:

  MEGDGGTPWALALLRTFDAGEFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDD
  RERMELLEEAKKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFR
  IIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDG
  LFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMVKVVKGH
  RPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNGLNGELIRQVLAALLPVTGRW
  RSPGEGFRLESEVIIRVTCPLSSPQEITSETEDLCEKPDDEVKETAHDLDVKSPPEPRSE
  VVPARLKRASAPTFDNDYSLSELLSQLDSGVSQAVEGPEELSRSSSESKLPSSGSGKRLS
  GVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVD
  LALDSGASLLHLAVEAGQEECAKWLLLNNANPNLSNRRGSTPLHMAVERRVRGVVELLLA
  RKISVNAKDEDQWTALHFAAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENI
  VRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAA
  QRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYT
  ALHLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFD
  EQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT

• Sequence length: 832

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Bartsocas-Papas syndrome 1	Likely pathogenic; Pathogenic	rs891831110, rs387906921, rs387906922, rs387906923, rs1354268287, rs1569100177	RCV001706914 RCV000023468 RCV000023469 RCV000023470 RCV000023471 RCV000710016	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Curly hair, ankyloblepharon, nail dysplasia syndrome	Pathogenic	rs199835696	RCV000710015	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARTSOCAS-PAPAS SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CURLY HAIR-ANKYLOBLEPHARON-NAIL DYSPLASIA SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECTODERMAL DYSPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECTODERMAL DYSPLASIA SYNDROME	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Popliteal pterygium syndrome	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RIPK4-related disorder	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Absent eyebrow	Absent eyebrow	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28574510		★☆☆☆☆ Found in Text Mining only
Alopecia totalis	Alopecia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28574510		★☆☆☆☆ Found in Text Mining only
Anodontia of Permanent Dentition	Anodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
ANONYCHIA	Anonychia	HPO_DG			★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	18025152		★☆☆☆☆ Found in Text Mining only
Bartsocas-Papas syndrome	Bartsocas-Papas Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31579820		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35186499	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31579820		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26148476, 35186499	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27697098		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	27697098		★☆☆☆☆ Found in Text Mining only
CHAND syndrome	CHAND Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
COCOON SYNDROME	Cocoon Syndrome	BEFREE	22197489, 25691407		★☆☆☆☆ Found in Text Mining only
Congenital ankyloblepharon	Congenital Ankyloblepharon	HPO_DG			★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23783273		★☆☆☆☆ Found in Text Mining only
Curly hair-ankyloblepharon-nail dysplasia syndrome	Curly Hair, Ankyloblepharon, Nail Dysplasia Syndrome	UNIPROT_DG	23610050, 26129644		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Curly hair-ankyloblepharon-nail dysplasia syndrome	Curly Hair, Ankyloblepharon, Nail Dysplasia Syndrome	ORPHANET_DG	25098893, 28940926		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Curly hair-ankyloblepharon-nail dysplasia syndrome	Curly Hair, Ankyloblepharon, Nail Dysplasia Syndrome	BEFREE	28940926		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Curly hair-ankyloblepharon-nail dysplasia syndrome	Curly Hair, Ankyloblepharon, Nail Dysplasia Syndrome	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	29257245		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31825120		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18025152		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	23783273		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	23783273	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	23783273	Associate	★☆☆☆☆ Found in Text Mining only
Hypohidrosis	Hypohidrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	29523099	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	BEFREE	30484821		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21044360	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24413083		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28574510	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28274793		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28274793		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28274793		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28274793		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28274793		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27697098	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28274793		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29436617		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	24519546		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31579820		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30212707		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27697098		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	39766280	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
NAIL DISORDER, NONSYNDROMIC CONGENITAL, 9	Nail Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nail dysplasia	Nail dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30212707		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18025152, 24413083, 25285922, 28574510, 29186361		★☆☆☆☆ Found in Text Mining only
Osseous ankylosis	Osseous Ankylosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29257245	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33487072, 33855091, 34124253, 35310605, 38179758	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29436617		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16036106	Associate	★☆☆☆☆ Found in Text Mining only
Popliteal pterygium syndrome	Popliteal Pterygium Syndrome	BEFREE	22197489, 25430793, 25691407, 28940926		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Popliteal Pterygium Syndrome	Popliteal pterygium syndrome	Pubtator	25246526, 25691407	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	22197488, 23371553, 23610050, 25430793, 25691407, 25784454, 26129644, 28940926, 29706531		★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	GENOMICS_ENGLAND_DG	22197488, 28425981		★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	ORPHANET_DG	22197488, 22197489		★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	UNIPROT_DG	22197488, 22197489		★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Prekallikrein deficiency	Prekallikrein Deficiency	BEFREE	29186361		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30044012		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	22197488, 25430793, 29317263		★☆☆☆☆ Found in Text Mining only
Pyogenic Arthritis, Pyoderma Gangrenosum and Acne	Pyogenic Arthritis, Pyoderma Gangrenosum And Acne	BEFREE	26129644		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25285922, 29186361		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24519546	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	25285922		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	24519546		★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Syndactyly of the toes	Syndactyly Of The Toes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Talipes	Talipes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thumb aplasia	Thumb Aplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	24519546	Inhibit	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	29867225		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29867225	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26148476, 27697098	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	25784454		★☆☆☆☆ Found in Text Mining only