FAM3B (FAM3 metabolism regulating signaling molecule B)

Gene

• Entrez ID: 54097
• Gene name: FAM3 metabolism regulating signaling molecule B
• Gene symbol: FAM3B
• Synonyms (NCBI Gene): 2-21, C21orf11, C21orf76, ORF9, PANDER, PRED44
• Chromosome: 21
• Chromosome location: 21q22.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019077	hsa-miR-335-5p	Microarray	18185580
MIRT984686	hsa-miR-1	CLIP-seq
MIRT984687	hsa-miR-181a	CLIP-seq
MIRT984688	hsa-miR-181b	CLIP-seq
MIRT984689	hsa-miR-181c	CLIP-seq
MIRT984690	hsa-miR-181d	CLIP-seq
MIRT984691	hsa-miR-206	CLIP-seq
MIRT984692	hsa-miR-3190	CLIP-seq
MIRT984693	hsa-miR-3673	CLIP-seq
MIRT984694	hsa-miR-4262	CLIP-seq
MIRT984695	hsa-miR-4752	CLIP-seq
MIRT984696	hsa-miR-613	CLIP-seq
MIRT984697	hsa-miR-636	CLIP-seq
MIRT2225916	hsa-miR-200b	CLIP-seq
MIRT2225917	hsa-miR-200c	CLIP-seq
MIRT2225918	hsa-miR-3163	CLIP-seq
MIRT2225919	hsa-miR-412	CLIP-seq
MIRT2225920	hsa-miR-429	CLIP-seq
MIRT2225921	hsa-miR-4774-5p	CLIP-seq
MIRT2225922	hsa-miR-548c-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	NAS	12160727
GO:0005515	Function	Protein binding	IPI	32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	12160727
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0030073	Process	Insulin secretion	IBA
GO:0030073	Process	Insulin secretion	IDA	12160727
GO:0030073	Process	Insulin secretion	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708

Other IDs

• MIM: 608617
• HGNC: 1253
• e!Ensembl: ENSG00000183844

Protein

• UniProt ID: P58499
• Protein name: Protein FAM3B (Cytokine-like protein 2-21) (Pancreatic-derived factor) (PANDER)
• Protein function: Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15711	ILEI	107 → 196	Interleukin-like EMT inducer	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis. {ECO:0000269|PubMed:16114871}.
• Sequence:

  MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKR
  QKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGN
  VTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIR
  NMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS

• Sequence length: 235

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LARGE ARTERY STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	23059759		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	3264692	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23246487		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28536423		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	26374847		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	28498330	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23059759		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22970209	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28161382		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28161382		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28161382, 29221790		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	20558441, 26374847		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	28498330	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30565387		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	21412813		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34278445	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	21412813, 24468680, 28536423		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26374847		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	30130742	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23059759, 23246487		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	22102710	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29357840, 30565387		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23059759		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25497279	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29178453		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29178453		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29357840		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16515873		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	23855304, 29221790		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23855304		★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	37105387	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29357840, 30565387		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29357840		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29775158, 37847647	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30565387		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21412813		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25173755, 32442162, 34840985	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	22136206, 23427895, 26960768, 30661062, 32316638	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26960768	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32471285	Associate	★☆☆☆☆ Found in Text Mining only