PNLIPRP2 (pancreatic lipase related protein 2 (gene/pseudogene))

Gene

• Entrez ID: 5408
• Gene name: Pancreatic lipase related protein 2 (gene/pseudogene)
• Gene symbol: PNLIPRP2
• Synonyms (NCBI Gene): PLRP2
• Chromosome: 10
• Chromosome location: 10q25.3
• Summary: This gene encodes a lipase that hydrolyzes galactolipids, the main components of plant membrane lipids. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the non-coding allele. [provided b

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019108	hsa-miR-335-5p	Microarray	18185580
MIRT019413	hsa-miR-148b-3p	Microarray	17612493

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004465	Function	Lipoprotein lipase activity	IBA
GO:0004620	Function	Phospholipase activity	IDA	17401110, 18702514
GO:0004806	Function	Triacylglycerol lipase activity	IDA	15287741, 17401110
GO:0004806	Function	Triacylglycerol lipase activity	IEA
GO:0004806	Function	Triacylglycerol lipase activity	ISS
GO:0004806	Function	Triacylglycerol lipase activity	TAS	1379598
GO:0005509	Function	Calcium ion binding	IDA	18702514
GO:0005515	Function	Protein binding	IPI	33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	1379598
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18702514
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0006641	Process	Triglyceride metabolic process	TAS	1379598
GO:0008970	Function	Phospholipase A1 activity	IBA
GO:0009395	Process	Phospholipid catabolic process	IBA
GO:0009395	Process	Phospholipid catabolic process	IDA	18702514
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016298	Function	Lipase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019376	Process	Galactolipid catabolic process	IDA	15287741, 17401110, 18702514, 20083229
GO:0019433	Process	Triglyceride catabolic process	IBA
GO:0019433	Process	Triglyceride catabolic process	IDA	15287741, 17401110
GO:0019433	Process	Triglyceride catabolic process	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034375	Process	High-density lipoprotein particle remodeling	IBA
GO:0034638	Process	Phosphatidylcholine catabolic process	IDA	17401110
GO:0042589	Component	Zymogen granule membrane	IEA
GO:0042632	Process	Cholesterol homeostasis	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0044241	Process	Lipid digestion	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0047372	Function	Monoacylglycerol lipase activity	IDA	17401110, 18702514
GO:0047372	Function	Monoacylglycerol lipase activity	TAS
GO:0047714	Function	Galactolipase activity	IBA
GO:0047714	Function	Galactolipase activity	IDA	15287741, 17401110, 18702514, 20083229
GO:0047714	Function	Galactolipase activity	IEA
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA

Other IDs

• MIM: 604423
• HGNC: 9157
• e!Ensembl: ENSG00000266200

Protein

• UniProt ID: P54317
• Protein name: Pancreatic lipase-related protein 2 (PL-RP2) (Cytotoxic T lymphocyte lipase) (Galactolipase) (EC 3.1.1.26) (Triacylglycerol lipase) (EC 3.1.1.3)
• Protein function: Lipase that primarily hydrolyzes triglycerides and galactosylglycerides (PubMed:15287741, PubMed:17401110, PubMed:18702514, PubMed:19451396, PubMed:20083229, PubMed:21865348, PubMed:26494624). In neonates, may play a major role in pancreatic dig
• PDB: 2OXE, 2PVS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00151	Lipase	18 → 354	Lipase	Domain
  PF01477	PLAT	359 → 465	PLAT/LH2 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Pancreas. {ECO:0000269|PubMed:10674344}.
• Sequence:

  MLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYT
  NENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNC
  ICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEA
  GRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKV
  GHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFL
  GYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYK
  ISVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKF
  LWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC

• Sequence length: 469

Pathways

KEGG:

Glycerolipid metabolism
Metabolic pathways
Pancreatic secretion
Fat digestion and absorption

Reactome:

Digestion of dietary lipid

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	30954473		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23918603, 31731384	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20514540, 23918603	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	16887271		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	30954473		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	30408063		★☆☆☆☆ Found in Text Mining only