Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54020
Gene name	Solute carrier family 37 member 1
Gene symbol	SLC37A1
Synonyms (NCBI Gene)	G3PPSPX1
Chromosome	21
Chromosome location	21q22.3
Summary	The protein encoded by this gene localizes to the endoplasmic reticulum (ER) membrane. This protein translocates glucose-6-phosphate from the cytoplasm into the lumen of the ER for hydrolysis into glucose by another ER membrane protein. This gene is a mem

128

Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016878	hsa-miR-335-5p	Microarray	18185580
MIRT085515	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT085516	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT739130	hsa-miR-4312	HITS-CLIP	33718276
MIRT1362085	hsa-miR-1231	CLIP-seq
MIRT1362086	hsa-miR-1266	CLIP-seq
MIRT1362087	hsa-miR-1321	CLIP-seq
MIRT1362088	hsa-miR-1909	CLIP-seq
MIRT1362089	hsa-miR-1914	CLIP-seq
MIRT1362090	hsa-miR-19a	CLIP-seq
MIRT1362091	hsa-miR-19b	CLIP-seq
MIRT1362092	hsa-miR-29a	CLIP-seq
MIRT1362093	hsa-miR-29b	CLIP-seq
MIRT1362094	hsa-miR-29c	CLIP-seq
MIRT1362095	hsa-miR-3124-3p	CLIP-seq
MIRT1362096	hsa-miR-3180-5p	CLIP-seq
MIRT1362097	hsa-miR-3182	CLIP-seq
MIRT1362098	hsa-miR-3545-3p	CLIP-seq
MIRT1362099	hsa-miR-3664-3p	CLIP-seq
MIRT1362100	hsa-miR-3918	CLIP-seq
MIRT1362101	hsa-miR-3942-5p	CLIP-seq
MIRT1362102	hsa-miR-4288	CLIP-seq
MIRT1362103	hsa-miR-4291	CLIP-seq
MIRT1362104	hsa-miR-4489	CLIP-seq
MIRT1362105	hsa-miR-4508	CLIP-seq
MIRT1362106	hsa-miR-4518	CLIP-seq
MIRT1362107	hsa-miR-4539	CLIP-seq
MIRT1362108	hsa-miR-4639-3p	CLIP-seq
MIRT1362109	hsa-miR-4703-5p	CLIP-seq
MIRT1362110	hsa-miR-4711-3p	CLIP-seq
MIRT1362111	hsa-miR-4733-3p	CLIP-seq
MIRT1362112	hsa-miR-4739	CLIP-seq
MIRT1362113	hsa-miR-4756-5p	CLIP-seq
MIRT1362114	hsa-miR-511	CLIP-seq
MIRT1362115	hsa-miR-545	CLIP-seq
MIRT1362116	hsa-miR-548an	CLIP-seq
MIRT1362117	hsa-miR-587	CLIP-seq
MIRT1362118	hsa-miR-632	CLIP-seq
MIRT1362119	hsa-miR-654-3p	CLIP-seq
MIRT1362120	hsa-miR-668	CLIP-seq
MIRT1362121	hsa-miR-764	CLIP-seq
MIRT1362085	hsa-miR-1231	CLIP-seq
MIRT1362087	hsa-miR-1321	CLIP-seq
MIRT1362088	hsa-miR-1909	CLIP-seq
MIRT1362090	hsa-miR-19a	CLIP-seq
MIRT1362091	hsa-miR-19b	CLIP-seq
MIRT2107238	hsa-miR-2117	CLIP-seq
MIRT1362095	hsa-miR-3124-3p	CLIP-seq
MIRT1362096	hsa-miR-3180-5p	CLIP-seq
MIRT1362097	hsa-miR-3182	CLIP-seq
MIRT2107239	hsa-miR-3688-5p	CLIP-seq
MIRT2107240	hsa-miR-3921	CLIP-seq
MIRT2107241	hsa-miR-3924	CLIP-seq
MIRT2107242	hsa-miR-4299	CLIP-seq
MIRT2107243	hsa-miR-4456	CLIP-seq
MIRT1362108	hsa-miR-4639-3p	CLIP-seq
MIRT2107244	hsa-miR-4653-5p	CLIP-seq
MIRT1362110	hsa-miR-4711-3p	CLIP-seq
MIRT2107245	hsa-miR-4716-5p	CLIP-seq
MIRT1362112	hsa-miR-4739	CLIP-seq
MIRT1362113	hsa-miR-4756-5p	CLIP-seq
MIRT1362114	hsa-miR-511	CLIP-seq
MIRT2107246	hsa-miR-541	CLIP-seq
MIRT1362116	hsa-miR-548an	CLIP-seq
MIRT2107247	hsa-miR-548q	CLIP-seq
MIRT2107248	hsa-miR-552	CLIP-seq
MIRT1362117	hsa-miR-587	CLIP-seq
MIRT1362119	hsa-miR-654-3p	CLIP-seq
MIRT2107249	hsa-miR-654-5p	CLIP-seq
MIRT1362120	hsa-miR-668	CLIP-seq
MIRT1362121	hsa-miR-764	CLIP-seq
MIRT2331355	hsa-miR-1229	CLIP-seq
MIRT1362085	hsa-miR-1231	CLIP-seq
MIRT1362086	hsa-miR-1266	CLIP-seq
MIRT2331356	hsa-miR-132	CLIP-seq
MIRT1362087	hsa-miR-1321	CLIP-seq
MIRT2331357	hsa-miR-1915	CLIP-seq
MIRT1362090	hsa-miR-19a	CLIP-seq
MIRT1362091	hsa-miR-19b	CLIP-seq
MIRT2331358	hsa-miR-212	CLIP-seq
MIRT1362092	hsa-miR-29a	CLIP-seq
MIRT1362093	hsa-miR-29b	CLIP-seq
MIRT1362094	hsa-miR-29c	CLIP-seq
MIRT2331359	hsa-miR-3120-5p	CLIP-seq
MIRT1362095	hsa-miR-3124-3p	CLIP-seq
MIRT1362096	hsa-miR-3180-5p	CLIP-seq
MIRT2331360	hsa-miR-3650	CLIP-seq
MIRT1362099	hsa-miR-3664-3p	CLIP-seq
MIRT2107239	hsa-miR-3688-5p	CLIP-seq
MIRT2331361	hsa-miR-378g	CLIP-seq
MIRT2331362	hsa-miR-3934	CLIP-seq
MIRT1362101	hsa-miR-3942-5p	CLIP-seq
MIRT2331363	hsa-miR-425	CLIP-seq
MIRT2331364	hsa-miR-4258	CLIP-seq
MIRT1362103	hsa-miR-4291	CLIP-seq
MIRT2107242	hsa-miR-4299	CLIP-seq
MIRT2331365	hsa-miR-4417	CLIP-seq
MIRT2331366	hsa-miR-4436b-3p	CLIP-seq
MIRT2331367	hsa-miR-4437	CLIP-seq
MIRT2107243	hsa-miR-4456	CLIP-seq
MIRT1362106	hsa-miR-4518	CLIP-seq
MIRT2331368	hsa-miR-4535	CLIP-seq
MIRT1362108	hsa-miR-4639-3p	CLIP-seq
MIRT2331369	hsa-miR-4643	CLIP-seq
MIRT2331370	hsa-miR-466	CLIP-seq
MIRT2331371	hsa-miR-4674	CLIP-seq
MIRT1362109	hsa-miR-4703-5p	CLIP-seq
MIRT2107245	hsa-miR-4716-5p	CLIP-seq
MIRT2331372	hsa-miR-4726-3p	CLIP-seq
MIRT2331373	hsa-miR-4731-5p	CLIP-seq
MIRT1362111	hsa-miR-4733-3p	CLIP-seq
MIRT1362112	hsa-miR-4739	CLIP-seq
MIRT2331374	hsa-miR-4752	CLIP-seq
MIRT1362113	hsa-miR-4756-5p	CLIP-seq
MIRT2331375	hsa-miR-4776-5p	CLIP-seq
MIRT2331376	hsa-miR-4789-3p	CLIP-seq
MIRT2107246	hsa-miR-541	CLIP-seq
MIRT1362115	hsa-miR-545	CLIP-seq
MIRT1362116	hsa-miR-548an	CLIP-seq
MIRT2107247	hsa-miR-548q	CLIP-seq
MIRT1362117	hsa-miR-587	CLIP-seq
MIRT2331377	hsa-miR-642b	CLIP-seq
MIRT1362119	hsa-miR-654-3p	CLIP-seq
MIRT2107249	hsa-miR-654-5p	CLIP-seq
MIRT1362120	hsa-miR-668	CLIP-seq
MIRT2331378	hsa-miR-711	CLIP-seq
MIRT2331379	hsa-miR-760	CLIP-seq
MIRT1362121	hsa-miR-764	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	21949678
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0015297	Function	Antiporter activity	IEA
GO:0015760	Process	Glucose-6-phosphate transport	IBA
GO:0015760	Process	Glucose-6-phosphate transport	IDA	21949678
GO:0015760	Process	Glucose-6-phosphate transport	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0031090	Component	Organelle membrane	IEA
GO:0035435	Process	Phosphate ion transmembrane transport	IBA
GO:0035435	Process	Phosphate ion transmembrane transport	IDA	21949678
GO:0035435	Process	Phosphate ion transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0061513	Function	Glucose 6-phosphate:phosphate antiporter activity	EXP	21949678
GO:0061513	Function	Glucose 6-phosphate:phosphate antiporter activity	IBA
GO:0061513	Function	Glucose 6-phosphate:phosphate antiporter activity	IDA	21949678
GO:0061513	Function	Glucose 6-phosphate:phosphate antiporter activity	IEA

MIM	HGNC	e!Ensembl
608094	11024	ENSG00000160190

P57057

Protein name

Glucose-6-phosphate exchanger SLC37A1 (Glycerol-3-phosphate permease) (G-3-P permease) (Solute carrier family 37 member 1)

Protein function

Inorganic phosphate and glucose-6-phosphate antiporter. May transport cytoplasmic glucose-6-phosphate into the lumen of the endoplasmic reticulum and translocate inorganic phosphate into the opposite direction. Independent of a lumenal glucose-6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	23 → 458	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in numerous tissues, with highest expression in pancreas, kidney, bone marrow, spleen, liver, small intestine, as well as in fetal brain, liver and spleen. {ECO:0000269|PubMed:11112347, ECO:0000269|PubMed:21949678}.

Sequence

MARLPAGIRFIISFSRDQWYRAFIFILTFLLYASFHLSRKPISIVKGELHKYCTAWDEAD
VRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNYQQLLGALDYSFLCAYAVGMYLSGII
GERLPIRYYLTFGMLASGAFTALFGLGYFYNIHSFGFYVVTQVINGLVQTTGWPSVVTCL
GNWFGKGRRGLIMGVWNSHTSVGNILGSLIAGYWVSTCWGLSFVVPGAIVAAMGIVCFLF
LIEHPNDVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKNKPLDPEMQCLLLSDGKGSIH
PNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHL
DAKKAGELSTLFDVGGIFGGILAGVISDRLEKRASTCGLMLLLAAPTLYIFSTVSKMGLE
ATIAMLLLSGALVSGPYTLITTAVSADLGTHKSLKGNAHALSTVTAIIDGTGSVGAALGP
LLAGLLSPSGWSNVFYMLMFADACALLFLIRLIHKELSCPGSATGDQVPFKEQ

Sequence length

533

Interactions

View interactions

	Reactome
			Gluconeogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	19894109	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29434906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19894109	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29719821	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28826615	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC37A1 (solute carrier family 37 member 1)