PRRX1 (paired related homeobox 1)

Gene

• Entrez ID: 5396
• Gene name: Paired related homeobox 1
• Gene symbol: PRRX1
• Synonyms (NCBI Gene): AGOTC, PHOX1, PMX1, PRX-1, PRX1
• Chromosome: 1
• Chromosome location: 1q24.2
• Summary: The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein r

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs387906667	T>C	Pathogenic	Coding sequence variant, missense variant
rs398122375	A>-,AAAAA	Pathogenic	Coding sequence variant, frameshift variant
rs1571354325	G>C	Pathogenic	Coding sequence variant, 3 prime UTR variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022167	hsa-miR-124-3p	Microarray	18668037
MIRT022167	hsa-miR-124-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705396
MIRT022167	hsa-miR-124-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705396
MIRT022167	hsa-miR-124-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705396
MIRT022167	hsa-miR-124-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705396
MIRT022167	hsa-miR-124-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705396
MIRT022167	hsa-miR-124-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705396
MIRT022167	hsa-miR-124-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705396
MIRT022167	hsa-miR-124-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705396
MIRT541963	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT555202	hsa-miR-382-3p	HITS-CLIP	21572407
MIRT510928	hsa-miR-378j	HITS-CLIP	21572407
MIRT510927	hsa-miR-6839-5p	HITS-CLIP	21572407
MIRT707304	hsa-miR-9-5p	HITS-CLIP	21572407
MIRT510926	hsa-miR-3201	HITS-CLIP	21572407
MIRT510925	hsa-miR-4791	HITS-CLIP	21572407
MIRT510924	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510923	hsa-miR-1299	HITS-CLIP	21572407
MIRT510922	hsa-miR-516b-5p	HITS-CLIP	21572407
MIRT510921	hsa-miR-4782-5p	HITS-CLIP	21572407
MIRT510920	hsa-miR-5706	HITS-CLIP	21572407
MIRT521621	hsa-miR-6844	HITS-CLIP	21572407
MIRT510929	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT541963	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT555202	hsa-miR-382-3p	HITS-CLIP	21572407
MIRT510928	hsa-miR-378j	HITS-CLIP	21572407
MIRT510927	hsa-miR-6839-5p	HITS-CLIP	21572407
MIRT510926	hsa-miR-3201	HITS-CLIP	21572407
MIRT510925	hsa-miR-4791	HITS-CLIP	21572407
MIRT510924	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510923	hsa-miR-1299	HITS-CLIP	21572407
MIRT510922	hsa-miR-516b-5p	HITS-CLIP	21572407
MIRT510921	hsa-miR-4782-5p	HITS-CLIP	21572407
MIRT510920	hsa-miR-5706	HITS-CLIP	21572407
MIRT510929	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT555202	hsa-miR-382-3p	PAR-CLIP	21572407
MIRT510928	hsa-miR-378j	PAR-CLIP	21572407
MIRT510927	hsa-miR-6839-5p	PAR-CLIP	21572407
MIRT510926	hsa-miR-3201	PAR-CLIP	21572407
MIRT510925	hsa-miR-4791	PAR-CLIP	21572407
MIRT510924	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510923	hsa-miR-1299	PAR-CLIP	21572407
MIRT510922	hsa-miR-516b-5p	PAR-CLIP	21572407
MIRT510921	hsa-miR-4782-5p	PAR-CLIP	21572407
MIRT510920	hsa-miR-5706	PAR-CLIP	21572407
MIRT510929	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT541963	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT510924	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510929	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT510929	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT510928	hsa-miR-378j	PAR-CLIP	23446348
MIRT510927	hsa-miR-6839-5p	PAR-CLIP	23446348
MIRT510926	hsa-miR-3201	PAR-CLIP	23446348
MIRT510925	hsa-miR-4791	PAR-CLIP	23446348
MIRT510924	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510923	hsa-miR-1299	PAR-CLIP	23446348
MIRT510922	hsa-miR-516b-5p	PAR-CLIP	23446348
MIRT510921	hsa-miR-4782-5p	PAR-CLIP	23446348
MIRT510920	hsa-miR-5706	PAR-CLIP	23446348
MIRT521621	hsa-miR-6844	PAR-CLIP	23446348
MIRT510929	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT510928	hsa-miR-378j	PAR-CLIP	23446348
MIRT510927	hsa-miR-6839-5p	PAR-CLIP	23446348
MIRT510926	hsa-miR-3201	PAR-CLIP	23446348
MIRT510925	hsa-miR-4791	PAR-CLIP	23446348
MIRT510924	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510923	hsa-miR-1299	PAR-CLIP	23446348
MIRT510922	hsa-miR-516b-5p	PAR-CLIP	23446348
MIRT510921	hsa-miR-4782-5p	PAR-CLIP	23446348
MIRT510920	hsa-miR-5706	PAR-CLIP	23446348
MIRT732202	hsa-miR-106b-5p	Luciferase reporter assay, Western blot	26617763
MIRT732202	hsa-miR-106b-5p	Luciferase reporter assay, Western blot	26617763
MIRT732451	hsa-miR-485-5p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	33620119
MIRT735297	hsa-miR-330-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR	32368097
MIRT541963	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT555202	hsa-miR-382-3p	HITS-CLIP	21572407
MIRT510928	hsa-miR-378j	HITS-CLIP	21572407
MIRT510927	hsa-miR-6839-5p	HITS-CLIP	21572407
MIRT707304	hsa-miR-9-5p	HITS-CLIP	21572407
MIRT510926	hsa-miR-3201	HITS-CLIP	21572407
MIRT510925	hsa-miR-4791	HITS-CLIP	21572407
MIRT510924	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510923	hsa-miR-1299	HITS-CLIP	21572407
MIRT510922	hsa-miR-516b-5p	HITS-CLIP	21572407
MIRT510921	hsa-miR-4782-5p	HITS-CLIP	21572407
MIRT510920	hsa-miR-5706	HITS-CLIP	21572407
MIRT521621	hsa-miR-6844	HITS-CLIP	21572407
MIRT510929	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT541963	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT555202	hsa-miR-382-3p	HITS-CLIP	21572407
MIRT510928	hsa-miR-378j	HITS-CLIP	21572407
MIRT510927	hsa-miR-6839-5p	HITS-CLIP	21572407
MIRT510926	hsa-miR-3201	HITS-CLIP	21572407
MIRT510925	hsa-miR-4791	HITS-CLIP	21572407
MIRT510924	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510923	hsa-miR-1299	HITS-CLIP	21572407
MIRT510922	hsa-miR-516b-5p	HITS-CLIP	21572407
MIRT510921	hsa-miR-4782-5p	HITS-CLIP	21572407
MIRT510920	hsa-miR-5706	HITS-CLIP	21572407
MIRT510929	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT555202	hsa-miR-382-3p	PAR-CLIP	21572407
MIRT510928	hsa-miR-378j	PAR-CLIP	21572407
MIRT510927	hsa-miR-6839-5p	PAR-CLIP	21572407
MIRT510926	hsa-miR-3201	PAR-CLIP	21572407
MIRT510925	hsa-miR-4791	PAR-CLIP	21572407
MIRT510924	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510923	hsa-miR-1299	PAR-CLIP	21572407
MIRT510922	hsa-miR-516b-5p	PAR-CLIP	21572407
MIRT510921	hsa-miR-4782-5p	PAR-CLIP	21572407
MIRT510920	hsa-miR-5706	PAR-CLIP	21572407
MIRT510929	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT541963	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT510924	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510929	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT510929	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT510928	hsa-miR-378j	PAR-CLIP	23446348
MIRT510927	hsa-miR-6839-5p	PAR-CLIP	23446348
MIRT510926	hsa-miR-3201	PAR-CLIP	23446348
MIRT510925	hsa-miR-4791	PAR-CLIP	23446348
MIRT510924	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510923	hsa-miR-1299	PAR-CLIP	23446348
MIRT510922	hsa-miR-516b-5p	PAR-CLIP	23446348
MIRT510921	hsa-miR-4782-5p	PAR-CLIP	23446348
MIRT510920	hsa-miR-5706	PAR-CLIP	23446348
MIRT521621	hsa-miR-6844	PAR-CLIP	23446348
MIRT510929	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT510928	hsa-miR-378j	PAR-CLIP	23446348
MIRT510927	hsa-miR-6839-5p	PAR-CLIP	23446348
MIRT510926	hsa-miR-3201	PAR-CLIP	23446348
MIRT510925	hsa-miR-4791	PAR-CLIP	23446348
MIRT510924	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510923	hsa-miR-1299	PAR-CLIP	23446348
MIRT510922	hsa-miR-516b-5p	PAR-CLIP	23446348
MIRT510921	hsa-miR-4782-5p	PAR-CLIP	23446348
MIRT510920	hsa-miR-5706	PAR-CLIP	23446348
MIRT1268317	hsa-miR-124	CLIP-seq
MIRT1268318	hsa-miR-1279	CLIP-seq
MIRT1268319	hsa-miR-1293	CLIP-seq
MIRT1268320	hsa-miR-1587	CLIP-seq
MIRT1268321	hsa-miR-2681	CLIP-seq
MIRT1268322	hsa-miR-3714	CLIP-seq
MIRT1268323	hsa-miR-3910	CLIP-seq
MIRT1268324	hsa-miR-4417	CLIP-seq
MIRT1268325	hsa-miR-4483	CLIP-seq
MIRT1268326	hsa-miR-4492	CLIP-seq
MIRT1268327	hsa-miR-4498	CLIP-seq
MIRT1268328	hsa-miR-455-5p	CLIP-seq
MIRT1268329	hsa-miR-4651	CLIP-seq
MIRT1268330	hsa-miR-4656	CLIP-seq
MIRT1268331	hsa-miR-4675	CLIP-seq
MIRT1268332	hsa-miR-4677-3p	CLIP-seq
MIRT1268333	hsa-miR-4741	CLIP-seq
MIRT1268334	hsa-miR-506	CLIP-seq
MIRT1268335	hsa-miR-541	CLIP-seq
MIRT1268336	hsa-miR-550a	CLIP-seq
MIRT1268337	hsa-miR-555	CLIP-seq
MIRT1268338	hsa-miR-608	CLIP-seq
MIRT1268339	hsa-miR-654-5p	CLIP-seq
MIRT1268340	hsa-miR-762	CLIP-seq
MIRT1268341	hsa-miR-1226	CLIP-seq
MIRT1268342	hsa-miR-1257	CLIP-seq
MIRT1268343	hsa-miR-15a	CLIP-seq
MIRT1268344	hsa-miR-15b	CLIP-seq
MIRT1268345	hsa-miR-16	CLIP-seq
MIRT1268346	hsa-miR-1825	CLIP-seq
MIRT1268347	hsa-miR-195	CLIP-seq
MIRT1268348	hsa-miR-197	CLIP-seq
MIRT1268349	hsa-miR-199a-5p	CLIP-seq
MIRT1268350	hsa-miR-199b-5p	CLIP-seq
MIRT1268351	hsa-miR-3119	CLIP-seq
MIRT1268352	hsa-miR-424	CLIP-seq
MIRT1268353	hsa-miR-4468	CLIP-seq
MIRT1268354	hsa-miR-4519	CLIP-seq
MIRT1268355	hsa-miR-451b	CLIP-seq
MIRT1268356	hsa-miR-4530	CLIP-seq
MIRT1268357	hsa-miR-455-3p	CLIP-seq
MIRT1268358	hsa-miR-4733-3p	CLIP-seq
MIRT1268359	hsa-miR-497	CLIP-seq
MIRT1268360	hsa-miR-548u	CLIP-seq
MIRT1268361	hsa-miR-634	CLIP-seq
MIRT1552617	hsa-miR-1179	CLIP-seq
MIRT1552618	hsa-miR-3120-3p	CLIP-seq
MIRT1268355	hsa-miR-451b	CLIP-seq
MIRT1268351	hsa-miR-3119	CLIP-seq
MIRT2078849	hsa-miR-1236	CLIP-seq
MIRT1268319	hsa-miR-1293	CLIP-seq
MIRT1268320	hsa-miR-1587	CLIP-seq
MIRT1268324	hsa-miR-4417	CLIP-seq
MIRT1268325	hsa-miR-4483	CLIP-seq
MIRT1268326	hsa-miR-4492	CLIP-seq
MIRT1268327	hsa-miR-4498	CLIP-seq
MIRT1268329	hsa-miR-4651	CLIP-seq
MIRT1268330	hsa-miR-4656	CLIP-seq
MIRT1268331	hsa-miR-4675	CLIP-seq
MIRT1268333	hsa-miR-4741	CLIP-seq
MIRT2078850	hsa-miR-4753-3p	CLIP-seq
MIRT1268335	hsa-miR-541	CLIP-seq
MIRT1268338	hsa-miR-608	CLIP-seq
MIRT1268339	hsa-miR-654-5p	CLIP-seq
MIRT1268340	hsa-miR-762	CLIP-seq
MIRT2305096	hsa-let-7a	CLIP-seq
MIRT2305097	hsa-let-7b	CLIP-seq
MIRT2305098	hsa-let-7c	CLIP-seq
MIRT2305099	hsa-let-7d	CLIP-seq
MIRT2305100	hsa-let-7e	CLIP-seq
MIRT2305101	hsa-let-7f	CLIP-seq
MIRT2305102	hsa-let-7g	CLIP-seq
MIRT2305103	hsa-let-7i	CLIP-seq
MIRT1268341	hsa-miR-1226	CLIP-seq
MIRT2305104	hsa-miR-1294	CLIP-seq
MIRT1268348	hsa-miR-197	CLIP-seq
MIRT2305105	hsa-miR-202	CLIP-seq
MIRT2305106	hsa-miR-2117	CLIP-seq
MIRT2305107	hsa-miR-22	CLIP-seq
MIRT2305108	hsa-miR-3649	CLIP-seq
MIRT2305109	hsa-miR-371-5p	CLIP-seq
MIRT2305110	hsa-miR-371b-5p	CLIP-seq
MIRT2305111	hsa-miR-4273	CLIP-seq
MIRT2305112	hsa-miR-4316	CLIP-seq
MIRT2305113	hsa-miR-4458	CLIP-seq
MIRT2305114	hsa-miR-4477a	CLIP-seq
MIRT2305115	hsa-miR-4500	CLIP-seq
MIRT1268332	hsa-miR-4677-3p	CLIP-seq
MIRT1268358	hsa-miR-4733-3p	CLIP-seq
MIRT2305116	hsa-miR-4795-3p	CLIP-seq
MIRT2305117	hsa-miR-492	CLIP-seq
MIRT2305118	hsa-miR-513c	CLIP-seq
MIRT2305119	hsa-miR-514b-5p	CLIP-seq
MIRT2305120	hsa-miR-98	CLIP-seq
MIRT2602195	hsa-miR-1261	CLIP-seq
MIRT2602196	hsa-miR-1283	CLIP-seq
MIRT2602197	hsa-miR-1292	CLIP-seq
MIRT2602198	hsa-miR-1321	CLIP-seq
MIRT2602199	hsa-miR-1827	CLIP-seq
MIRT2602200	hsa-miR-2053	CLIP-seq
MIRT2305107	hsa-miR-22	CLIP-seq
MIRT2602201	hsa-miR-31	CLIP-seq
MIRT2602202	hsa-miR-3115	CLIP-seq
MIRT2602203	hsa-miR-3128	CLIP-seq
MIRT2602204	hsa-miR-3156-5p	CLIP-seq
MIRT2602205	hsa-miR-3157-3p	CLIP-seq
MIRT2602206	hsa-miR-3161	CLIP-seq
MIRT2602207	hsa-miR-323-5p	CLIP-seq
MIRT2602208	hsa-miR-3622b-5p	CLIP-seq
MIRT2602209	hsa-miR-3646	CLIP-seq
MIRT2602210	hsa-miR-3652	CLIP-seq
MIRT2305109	hsa-miR-371-5p	CLIP-seq
MIRT2305110	hsa-miR-371b-5p	CLIP-seq
MIRT1268323	hsa-miR-3910	CLIP-seq
MIRT2602211	hsa-miR-3928	CLIP-seq
MIRT2602212	hsa-miR-3940-5p	CLIP-seq
MIRT2602213	hsa-miR-412	CLIP-seq
MIRT2602214	hsa-miR-4259	CLIP-seq
MIRT2602215	hsa-miR-4275	CLIP-seq
MIRT2602216	hsa-miR-4282	CLIP-seq
MIRT2602217	hsa-miR-4419a	CLIP-seq
MIRT2602218	hsa-miR-4422	CLIP-seq
MIRT2602219	hsa-miR-4430	CLIP-seq
MIRT2602220	hsa-miR-4461	CLIP-seq
MIRT2602221	hsa-miR-4471	CLIP-seq
MIRT2602222	hsa-miR-4494	CLIP-seq
MIRT2602223	hsa-miR-4505	CLIP-seq
MIRT2602224	hsa-miR-4507	CLIP-seq
MIRT2602225	hsa-miR-4510	CLIP-seq
MIRT1268355	hsa-miR-451b	CLIP-seq
MIRT2602226	hsa-miR-4642	CLIP-seq
MIRT2602227	hsa-miR-4646-5p	CLIP-seq
MIRT2602228	hsa-miR-4703-3p	CLIP-seq
MIRT2602229	hsa-miR-4715-5p	CLIP-seq
MIRT2602230	hsa-miR-4720-3p	CLIP-seq
MIRT2602231	hsa-miR-4733-5p	CLIP-seq
MIRT2602232	hsa-miR-4739	CLIP-seq
MIRT2602233	hsa-miR-4756-5p	CLIP-seq
MIRT2602234	hsa-miR-499a-5p	CLIP-seq
MIRT2305118	hsa-miR-513c	CLIP-seq
MIRT2305119	hsa-miR-514b-5p	CLIP-seq
MIRT2602235	hsa-miR-520d-5p	CLIP-seq
MIRT2602236	hsa-miR-524-5p	CLIP-seq
MIRT2602237	hsa-miR-548aa	CLIP-seq
MIRT2602238	hsa-miR-548c-3p	CLIP-seq
MIRT2602239	hsa-miR-549	CLIP-seq
MIRT2602240	hsa-miR-579	CLIP-seq
MIRT2602241	hsa-miR-629	CLIP-seq
MIRT2602242	hsa-miR-643	CLIP-seq
MIRT2602243	hsa-miR-668	CLIP-seq
MIRT2602244	hsa-miR-765	CLIP-seq
MIRT2602245	hsa-miR-876-3p	CLIP-seq
MIRT2602246	hsa-miR-892b	CLIP-seq
MIRT2602195	hsa-miR-1261	CLIP-seq
MIRT2602196	hsa-miR-1283	CLIP-seq
MIRT2602197	hsa-miR-1292	CLIP-seq
MIRT2602198	hsa-miR-1321	CLIP-seq
MIRT2602199	hsa-miR-1827	CLIP-seq
MIRT2688781	hsa-miR-1910	CLIP-seq
MIRT2305107	hsa-miR-22	CLIP-seq
MIRT2602201	hsa-miR-31	CLIP-seq
MIRT2602202	hsa-miR-3115	CLIP-seq
MIRT2602203	hsa-miR-3128	CLIP-seq
MIRT2602204	hsa-miR-3156-5p	CLIP-seq
MIRT2602205	hsa-miR-3157-3p	CLIP-seq
MIRT2602206	hsa-miR-3161	CLIP-seq
MIRT2602207	hsa-miR-323-5p	CLIP-seq
MIRT2688782	hsa-miR-34b	CLIP-seq
MIRT2602208	hsa-miR-3622b-5p	CLIP-seq
MIRT2602209	hsa-miR-3646	CLIP-seq
MIRT2602210	hsa-miR-3652	CLIP-seq
MIRT2305109	hsa-miR-371-5p	CLIP-seq
MIRT2305110	hsa-miR-371b-5p	CLIP-seq
MIRT1268323	hsa-miR-3910	CLIP-seq
MIRT2602211	hsa-miR-3928	CLIP-seq
MIRT2602212	hsa-miR-3940-5p	CLIP-seq
MIRT2602213	hsa-miR-412	CLIP-seq
MIRT2602214	hsa-miR-4259	CLIP-seq
MIRT2602215	hsa-miR-4275	CLIP-seq
MIRT2602216	hsa-miR-4282	CLIP-seq
MIRT2602217	hsa-miR-4419a	CLIP-seq
MIRT2602218	hsa-miR-4422	CLIP-seq
MIRT2602219	hsa-miR-4430	CLIP-seq
MIRT2602220	hsa-miR-4461	CLIP-seq
MIRT2602221	hsa-miR-4471	CLIP-seq
MIRT2602222	hsa-miR-4494	CLIP-seq
MIRT2602223	hsa-miR-4505	CLIP-seq
MIRT2602224	hsa-miR-4507	CLIP-seq
MIRT2602225	hsa-miR-4510	CLIP-seq
MIRT1268355	hsa-miR-451b	CLIP-seq
MIRT1268357	hsa-miR-455-3p	CLIP-seq
MIRT2602226	hsa-miR-4642	CLIP-seq
MIRT2602227	hsa-miR-4646-5p	CLIP-seq
MIRT2688783	hsa-miR-4694-3p	CLIP-seq
MIRT2602228	hsa-miR-4703-3p	CLIP-seq
MIRT2602229	hsa-miR-4715-5p	CLIP-seq
MIRT2602230	hsa-miR-4720-3p	CLIP-seq
MIRT2602231	hsa-miR-4733-5p	CLIP-seq
MIRT2602232	hsa-miR-4739	CLIP-seq
MIRT2602233	hsa-miR-4756-5p	CLIP-seq
MIRT2602234	hsa-miR-499a-5p	CLIP-seq
MIRT2305118	hsa-miR-513c	CLIP-seq
MIRT2305119	hsa-miR-514b-5p	CLIP-seq
MIRT2602235	hsa-miR-520d-5p	CLIP-seq
MIRT2602236	hsa-miR-524-5p	CLIP-seq
MIRT2602237	hsa-miR-548aa	CLIP-seq
MIRT2602238	hsa-miR-548c-3p	CLIP-seq
MIRT2602239	hsa-miR-549	CLIP-seq
MIRT2688784	hsa-miR-561	CLIP-seq
MIRT2602240	hsa-miR-579	CLIP-seq
MIRT2602241	hsa-miR-629	CLIP-seq
MIRT2688785	hsa-miR-640	CLIP-seq
MIRT2602242	hsa-miR-643	CLIP-seq
MIRT2602243	hsa-miR-668	CLIP-seq
MIRT2688786	hsa-miR-7	CLIP-seq
MIRT2602244	hsa-miR-765	CLIP-seq
MIRT2602245	hsa-miR-876-3p	CLIP-seq
MIRT2602246	hsa-miR-892b	CLIP-seq
MIRT2688787	hsa-miR-944	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SRF	Unknown	18604245

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	1509260
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9334314
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0010463	Process	Mesenchymal cell proliferation	IEA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IEA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042474	Process	Middle ear morphogenesis	IEA
GO:0045880	Process	Positive regulation of smoothened signaling pathway	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9334314
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048664	Process	Neuron fate determination	IEA
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0048844	Process	Artery morphogenesis	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	9334314
GO:0070570	Process	Regulation of neuron projection regeneration	IEA
GO:0071837	Function	HMG box domain binding	IEA
GO:0072089	Process	Stem cell proliferation	IEA
GO:0097150	Process	Neuronal stem cell population maintenance	IEA
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA

Other IDs

• MIM: 167420
• HGNC: 9142
• e!Ensembl: ENSG00000116132

Protein

• UniProt ID: P54821
• Protein name: Paired mesoderm homeobox protein 1 (Homeobox protein PHOX1) (Paired-related homeobox protein 1) (PRX-1)
• Protein function: Master transcription factor of stromal fibroblasts for myofibroblastic lineage progression. Orchestrates the functional drift of fibroblasts into myofibroblastic phenotype via TGF-beta signaling by remodeling a super-enhancer landscape. Through
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	95 → 151	Homeodomain	Domain
  PF03826	OAR	219 → 236	OAR motif	Motif

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: Widely expressed in embryonic and adult tissues, with highest levels in skeletal muscle. Isoform 1 is either expressed at similar or higher levels compared to isoform 2 in all embryonic tissues but skeletal muscle and hear
• Sequence:

  MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEA
  GRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPD
  AFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIV
  PRPAPRPTDYLSWGTASPYSAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQ
  VPTVN

• Sequence length: 245

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Agnathia-otocephaly complex	Pathogenic; Likely pathogenic	rs387906667, rs1571354325, rs398122375, rs1655023196	RCV000022701 RCV000022702 RCV000043529 RCV000043530 RCV001261984	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC STENOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC EMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOSYNOSTOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMYELINATING DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSGNATHIA COMPLEX	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRRX1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETROGNATHIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	29424489		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Agnathia-holoprosencephaly-situs inversus syndrome	Agnathia-Holoprosencephaly-Situs Inversus Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30705403		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19205907		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19205907		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	22544366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	24239840, 25391453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	24239840, 25953654, 29545482, 34845933	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	28416818, 29892015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Beta thalassemia intermedia	beta Thalassemia	BEFREE	30521599		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19566940, 23807160, 28337269, 31595162		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23807160, 32945446	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38308202	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	29424489, 35032368	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34496784	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36968142	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16414373, 16635084, 17084559, 23615915, 28337269, 28469771		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31490389	Associate	★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	11509333		★☆☆☆☆ Found in Text Mining only
Clinically Isolated Syndrome, CNS Demyelinating	Demyelinating Diseases	CTD_human_DG	30566868		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23807160, 24705396, 26617763		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23807160, 24705396, 26617763, 34286520, 36968142	Associate	★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital absence of mandible	Mandibular aplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of penis	Congenital Hypoplasia Of Penis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital retrognathism	Congenital Retrognathism	BEFREE	23444262		★☆☆☆☆ Found in Text Mining only
Congenital retrognathism	Congenital Retrognathism	CTD_human_DG	23444262		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31490389		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	25556649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cyclocephaly	Cyclocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27792866		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	CTD_human_DG	30566868		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28736931		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	30132841	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	12650976		★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	27119349		★☆☆☆☆ Found in Text Mining only
Dysgnathia complex	Dysgnathia Complex	ORPHANET_DG	21294718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysgnathia complex	Dysgnathia Complex	CTD_human_DG	23444262		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysgnathia complex	Dysgnathia complex	Pubtator	32100971	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic Esophagitis	Eosinophilia	Pubtator	39343172	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21468086		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21468086		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37866660	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	17586524, 18296734, 28737764, 30193772		★☆☆☆☆ Found in Text Mining only
Geleophysic dysplasia	Geleophysic Dysplasia	BEFREE	30738849		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32857719	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34214250	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	28695825		★☆☆☆☆ Found in Text Mining only
Hereditary pyropoikilocytosis	Hereditary pyropoikilocytosis	BEFREE	27582029		★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASCAT_DG	22566498		★☆☆☆☆ Found in Text Mining only
Hypoplasia of the epiglottis	Hypoplasia of the epiglottis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30069061		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	29986096	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal hypoplasia	Laryngeal hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18604245		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10397741	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10397741	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10397741		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25188510, 25404478, 28677793, 31752959		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	18296734		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31490389	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32862590	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19566940, 23807160, 28337269, 31595162		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21468086		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28337269		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16635084, 17084559, 23615915, 28337269, 28469771		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26773005, 30705403		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	19208208		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	15955662		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17606720, 23201163, 25404478, 26689287, 28469771, 28677793, 30622052, 31185618, 31712603		★☆☆☆☆ Found in Text Mining only
Microglossia	Microglossia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	18604245		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16651408		★☆☆☆☆ Found in Text Mining only
Nager syndrome	Nager Syndrome	BEFREE	11063257		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15955662, 17234762, 18413821, 19566940, 23615915, 28486630, 28677793, 29088845, 30622052, 31490389		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28241840		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18413821		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23250756		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28569405		★☆☆☆☆ Found in Text Mining only
Otocephaly	Otocephaly	ORPHANET_DG	21294718		★☆☆☆☆ Found in Text Mining only
Otocephaly	Otocephaly	UNIPROT_DG	21294718		★☆☆☆☆ Found in Text Mining only
Otocephaly	Otocephaly	BEFREE	22198066, 23444262		★☆☆☆☆ Found in Text Mining only
Otocephaly	Otocephaly	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33563317	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26773005, 30705403		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26773005, 30705403		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28823893		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	22544366		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	12650976		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	19208208		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Situs inversus totalis	Situs Inversus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15955662		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30622052		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	15955662		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32862590	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30351993		★☆☆☆☆ Found in Text Mining only
Synotus	Synotus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tongue absent	Aglossia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tracheomalacia	Tracheomalacia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26820102		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	30696882		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33204728	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	35281030	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	16782755	Associate	★☆☆☆☆ Found in Text Mining only