Gene Gene information from NCBI Gene database.
Entrez ID 5395
Gene name PMS1 homolog 2, mismatch repair system component
Gene symbol PMS2
Synonyms (NCBI Gene)
HNPCC4LYNCH4MLH4MMRCS4PMS-2PMS2CLPMSL2
Chromosome 7
Chromosome location 7p22.1
Summary The protein encoded by this gene is a key component of the mismatch repair system that functions to correct DNA mismatches and small insertions and deletions that can occur during DNA replication and homologous recombination. This protein forms heterodime
SNPs SNP information provided by dbSNP.
347
SNP ID Visualize variation Clinical significance Consequence
rs1805322 G>A,T Uncertain-significance, benign-likely-benign, conflicting-interpretations-of-pathogenicity, likely-benign Upstream transcript variant, intron variant, 5 prime UTR variant, missense variant, non coding transcript variant, coding sequence variant, genic upstream transcript variant
rs2345056 G>A,C Conflicting-interpretations-of-pathogenicity, uncertain-significance Genic upstream transcript variant, intron variant
rs3209663 C>A,T Pathogenic Intron variant, stop gained, 5 prime UTR variant, missense variant, non coding transcript variant, coding sequence variant, genic upstream transcript variant
rs36038802 G>A,T Pathogenic Non coding transcript variant, stop gained, genic upstream transcript variant, 5 prime UTR variant, missense variant, coding sequence variant
rs56203955 T>C,G Uncertain-significance, conflicting-interpretations-of-pathogenicity Non coding transcript variant, genic upstream transcript variant, 5 prime UTR variant, missense variant, intron variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
12
miRTarBase ID miRNA Experiments Reference
MIRT048727 hsa-miR-96-5p CLASH 23622248
MIRT043223 hsa-miR-324-5p CLASH 23622248
MIRT736983 hsa-miR-4328 MicroarrayImmunohistochemistry (IHC) 32170146
MIRT2072356 hsa-miR-4455 CLIP-seq
MIRT2072357 hsa-miR-4506 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
41
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003677 Function DNA binding IDA 10871409
GO:0003677 Function DNA binding IEA
GO:0003697 Function Single-stranded DNA binding IDA 11809883
GO:0004518 Function Nuclease activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600259 9122 ENSG00000122512
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P54278
Protein name Mismatch repair endonuclease PMS2 (EC 3.1.-.-) (DNA mismatch repair protein PMS2) (PMS1 protein homolog 2)
Protein function Component of the post-replicative DNA mismatch repair system (MMR) (PubMed:30653781, PubMed:35189042). Heterodimerizes with MLH1 to form MutL alpha. DNA repair is initiated by MutS alpha (MSH2-MSH6) or MutS beta (MSH2-MSH3) binding to a dsDNA mi
PDB 1EA6 , 1H7S , 1H7U , 5U5R , 6MFQ , 7RCB , 7RCI , 7RCK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13589 HATPase_c_3 33 161 Domain
PF01119 DNA_mis_repair 248 363 DNA mismatch repair protein, C-terminal domain Family
PF08676 MutL_C 676 822 MutL C terminal dimerisation domain Domain
Sequence
MERAESSSTEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKD
YGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDV
TISTCHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQ
LFSTLPVRHKEFQRNIKKE
YAKMVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSVFGQKQLQSLI
PFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPA
KVCRLVNEVYHMYNRHQYPFVVLNISVDSECVDINVTPDKRQILLQEEKLLLAVLKTSLI
GMF
DSDVNKLNVSQQPLLDVEGNLIKMHAADLEKPMVEKQDQSPSLRTGEEKKDVSISRL
REAFSLRHTTENKPHSPKTPEPRRSPLGQKRGMLSSSTSGAISDKGVLRPQKEAVSSSHG
PSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEYAASSPGDRGSQEHVDSQEKAP
KTDDSFSDVDCHSNQEDTGCKFRVLPQPTNLATPNTKRFKKEEILSSSDICQKLVNTQDM
SASQVDVAVKINKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA
EDELRKEISKTMFAEMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQG
QRLIAPQTLNLTAVNEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGP
QDVDELIFMLSDSPGVMCRPSRVKQMFASRACRKSVMIGTAL
NTSEMKKLITHMGEMDHP
WNCPHGRPTMRHIANLGVISQN
Sequence length 862
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Mismatch repair
Fanconi anemia pathway
  Mismatch repair (MMR) directed by MSH2:MSH6 (MutSalpha)
Defective Mismatch Repair Associated With MLH1
Defective Mismatch Repair Associated With PMS2
TP53 Regulates Transcription of DNA Repair Genes
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
73
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Adrenocortical carcinoma, hereditary Pathogenic rs267608172 RCV005886125
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Breast and/or ovarian cancer Likely pathogenic; Pathogenic rs587779340, rs121434629, rs267608161, rs267608172, rs267608150 RCV003149993
RCV001797999
RCV001798271
RCV003149756
RCV003149757
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Breast carcinoma Likely pathogenic rs587782074, rs2128799493 RCV001559122
RCV001579296
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Breast-ovarian cancer, familial, susceptibility to, 1 Likely pathogenic; Pathogenic rs267608161 RCV005861047
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Likely benign; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CANCER GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Breast neoplasm Conflicting classifications of pathogenicity; Uncertain significance; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CAFE-AU-LAIT SPOTS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 22833088, 27258561
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of colon Adenocarcinoma Of Colon BEFREE 23582141
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of large intestine Colorectal Cancer BEFREE 20632815
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of large intestine Colorectal Cancer CGI_DG
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of pancreas Pancreatic adenocarcinoma HPO_DG
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 21376568, 27990589, 29976631, 31649038
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 28726808, 29146522, 30324682, 9062584
★☆☆☆☆
Found in Text Mining only
Adult Medulloblastoma Medulloblastoma BEFREE 19283792, 23582141
★☆☆☆☆
Found in Text Mining only
Agnosia Agnosia HPO_DG
★☆☆☆☆
Found in Text Mining only