DUOX1 (dual oxidase 1)

Gene

• Entrez ID: 53905
• Gene name: Dual oxidase 1
• Gene symbol: DUOX1
• Synonyms (NCBI Gene): LNOX1, NOXEF1, THOX1
• Chromosome: 15
• Chromosome location: 15q21.1
• Summary: The protein encoded by this gene is a glycoprotein and a member of the NADPH oxidase family. The synthesis of thyroid hormone is catalyzed by a protein complex located at the apical membrane of thyroid follicular cells. This complex contains an iodide tra

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT947272	hsa-miR-151-3p	CLIP-seq
MIRT947273	hsa-miR-3152-3p	CLIP-seq
MIRT947274	hsa-miR-342-5p	CLIP-seq
MIRT947275	hsa-miR-4463	CLIP-seq
MIRT947276	hsa-miR-4499	CLIP-seq
MIRT947277	hsa-miR-4651	CLIP-seq
MIRT947278	hsa-miR-4664-5p	CLIP-seq
MIRT947279	hsa-miR-4694-5p	CLIP-seq
MIRT947280	hsa-miR-608	CLIP-seq
MIRT1980583	hsa-miR-1285	CLIP-seq
MIRT1980584	hsa-miR-3187-5p	CLIP-seq
MIRT1980585	hsa-miR-34a	CLIP-seq
MIRT1980586	hsa-miR-34c-5p	CLIP-seq
MIRT1980587	hsa-miR-449a	CLIP-seq
MIRT1980588	hsa-miR-449b	CLIP-seq
MIRT1980589	hsa-miR-612	CLIP-seq
MIRT2448581	hsa-miR-1827	CLIP-seq
MIRT2448582	hsa-miR-202	CLIP-seq
MIRT2448583	hsa-miR-3153	CLIP-seq
MIRT2448584	hsa-miR-3689a-3p	CLIP-seq
MIRT2448585	hsa-miR-3689c	CLIP-seq
MIRT2448586	hsa-miR-3689d	CLIP-seq
MIRT2448587	hsa-miR-3919	CLIP-seq
MIRT2448588	hsa-miR-3929	CLIP-seq
MIRT2448589	hsa-miR-4419b	CLIP-seq
MIRT2448590	hsa-miR-4425	CLIP-seq
MIRT2448591	hsa-miR-4476	CLIP-seq
MIRT2448592	hsa-miR-4478	CLIP-seq
MIRT2448593	hsa-miR-4649-3p	CLIP-seq
MIRT2448594	hsa-miR-4668-5p	CLIP-seq
MIRT2448595	hsa-miR-4701-5p	CLIP-seq
MIRT2448596	hsa-miR-4728-5p	CLIP-seq
MIRT2448597	hsa-miR-4756-3p	CLIP-seq
MIRT2448598	hsa-miR-588	CLIP-seq
MIRT2448599	hsa-miR-619	CLIP-seq
MIRT2448600	hsa-miR-624	CLIP-seq
MIRT2448601	hsa-miR-765	CLIP-seq
MIRT2448602	hsa-miR-939	CLIP-seq
MIRT2448582	hsa-miR-202	CLIP-seq
MIRT2448601	hsa-miR-765	CLIP-seq
MIRT2448602	hsa-miR-939	CLIP-seq
MIRT2448582	hsa-miR-202	CLIP-seq
MIRT2519995	hsa-miR-4789-3p	CLIP-seq
MIRT2448601	hsa-miR-765	CLIP-seq
MIRT2448602	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004601	Function	Peroxidase activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	19339556, 33420071
GO:0005783	Component	Endoplasmic reticulum	IDA	19339556
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	19339556
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006590	Process	Thyroid hormone generation	IEA
GO:0006590	Process	Thyroid hormone generation	TAS
GO:0006952	Process	Defense response	IBA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0009986	Component	Cell surface	IGI	22814254
GO:0016020	Component	Membrane	IEA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IBA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IEA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	NAS	10806195
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	TAS
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IBA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	NAS	10806195
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	16111680
GO:0020037	Function	Heme binding	IEA
GO:0031252	Component	Cell leading edge	IEA
GO:0031252	Component	Cell leading edge	IGI	19339556
GO:0042335	Process	Cuticle development	IMP	11514595
GO:0042446	Process	Hormone biosynthetic process	IEA
GO:0042554	Process	Superoxide anion generation	IBA
GO:0042554	Process	Superoxide anion generation	NAS	10806195
GO:0042744	Process	Hydrogen peroxide catabolic process	IEA
GO:0043020	Component	NADPH oxidase complex	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0050661	Function	NADP binding	NAS	10806195
GO:0050665	Process	Hydrogen peroxide biosynthetic process	IEA
GO:0050665	Process	Hydrogen peroxide biosynthetic process	IGI	19339556, 22814254
GO:0050665	Process	Hydrogen peroxide biosynthetic process	NAS	10806195
GO:0051591	Process	Response to cAMP	IDA	15062544
GO:0051591	Process	Response to cAMP	IEA
GO:0051591	Process	Response to cAMP	ISS
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0090303	Process	Positive regulation of wound healing	IEA
GO:0090303	Process	Positive regulation of wound healing	IGI	19339556
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:2000147	Process	Positive regulation of cell motility	IGI	19339556

Other IDs

• MIM: 606758
• HGNC: 3062
• e!Ensembl: ENSG00000137857

Protein

• UniProt ID: Q9NRD9
• Protein name: Dual oxidase 1 (EC 1.11.1.-) (EC 1.6.3.1) (Large NOX 1) (Long NOX 1) (NADPH thyroid oxidase 1) (Thyroid oxidase 1)
• Protein function: Generates hydrogen peroxide which is required for the activity of thyroid peroxidase/TPO and lactoperoxidase/LPO. Plays a role in thyroid hormones synthesis and lactoperoxidase-mediated antimicrobial defense at the surface of mucosa. May have it
• PDB: 7D3E, 7D3F
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03098	An_peroxidase	29 → 557	Animal haem peroxidase	Domain
  PF00036	EF-hand_1	819 → 847	EF hand	Domain
  PF00036	EF-hand_1	856 → 883	EF hand	Domain
  PF01794	Ferric_reduct	1087 → 1236	Ferric reductase like transmembrane component	Family
  PF08022	FAD_binding_8	1272 → 1374	FAD-binding domain	Domain
  PF08030	NAD_binding_6	1380 → 1534	Ferric reductase NAD binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in thyrocytes and tracheal surface epithelial cells (at protein level). Expressed in thyroid, trachea, bronchium, and to a lower extent, in placenta, testis, prostate, pancreas and heart. {ECO:0000269|PubMed:10806195, ECO:000
• Sequence:

  MGFCLALAWTLLVGAWTPLGAQNPISWEVQRFDGWYNNLMEHRWGSKGSRLQRLVPASYA
  DGVYQPLGEPHLPNPRDLSNTISRGPAGLASLRNRTVLGVFFGYHVLSDLVSVETPGCPA
  EFLNIRIPPGDPMFDPDQRGDVVLPFQRSRWDPETGRSPSNPRDPANQVTGWLDGSAIYG
  SSHSWSDALRSFSRGQLASGPDPAFPRDSQNPLLMWAAPDPATGQNGPRGLYAFGAERGN
  REPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHARKRVIATYQNIAVYEWLPSFL
  QKTLPEYTGYRPFLDPSISSEFVAASEQFLSTMVPPGVYMRNASCHFQGVINRNSSVSRA
  LRVCNSYWSREHPSLQSAEDVDALLLGMASQIAEREDHVLVEDVRDFWPGPLKFSRTDHL
  ASCLQRGRDLGLPSYTKARAALGLSPITRWQDINPALSRSNDTVLEATAALYNQDLSWLE
  LLPGGLLESHRDPGPLFSTIVLEQFVRLRDGDRYWFENTRNGLFSKKEIEEIRNTTLQDV
  LVAVINIDPSALQPNVFVWHKGDPCPQPRQLSTEGLPACAPSVVRDYFEGSGFGFGVTIG
  TLCCFPLVSLLSAWIVARLRMRNFKRLQGQDRQSIVSEKLVGGMEALEWQGHKEPCRPVL
  VYLQPGQIRVVDGRLTVLRTIQLQPPQKVNFVLSSNRGRRTLLLKIPKEYDLVLLFNLEE
  ERQALVENLRGALKESGLSIQEWELREQELMRAAVTREQRRHLLETFFRHLFSQVLDINQ
  ADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLSFREF
  LDILVVFMKGSPEEKSRLMFRMYDFDGNGLISKDEFIRMLRSFIEISNNCLSKAQLAEVV
  ESMFRESGFQDKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQD
  MICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHRE
  KFQRSCLHQTVQQFKRFIENYRRHIGCVAVFYAIAGGLFLERAYYYAFAAHHTGITDTTR
  VGIILSRGTAASISFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRLIASTAIVL
  TVLHSVGHVVNVYLFSISPLSVLSCLFPGLFHDDGSELPQKYYWWFFQTVPGLTGVVLLL
  ILAIMYVFASHHFRRRSFRGFWLTHHLYILLYVLLIIHGSFALIQLPRFHIFFLVPAIIY
  GGDKLVSLSRKKVEISVVKAELLPSGVTHLRFQRPQGFEYKSGQWVRIACLALGTTEYHP
  FTLTSAPHEDTLSLHIRAAGPWTTRLREIYSAPTGDRCARYPKLYLDGPFGEGHQEWHKF
  EVSVLVGGGIGVTPFASILKDLVFKSSVSCQVFCKKIYFIWVTRTQRQFEWLADIIREVE
  ENDHQDLVSVHIYITQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPFEP
  FFNSLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLINRQDRTHFSHHYENF

• Sequence length: 1551

Pathways

KEGG:

Thyroid hormone synthesis

Reactome:

Thyroxine biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUOX1-related disorder	Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	18281478		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	29781053		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30172425		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27815990		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30615595		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	26988591, 27634835		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27815990, 29861101		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29849884		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29849884	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21915726	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21915726, 27079415, 27108801, 28894215	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18281478, 28578013		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31706280	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	28548478		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27910195		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30761998		★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	20493396, 21367720, 23636897, 27044504, 29018441, 29050515, 29702544, 29741690, 31847541, 8551399, 8555500		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18177232		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	18177232		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	23281318		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35712285	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	16651268, 17684392, 21367925, 28633507, 31172499, 31428054		★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital hypothyroidism	Pubtator	28633507	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22747566, 23553616		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22613645		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	22613645		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22613645		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	23281318		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	31167233		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	14679084		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28548478, 30188871		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29367111		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	29877948		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30937971		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	11762710		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	19531958		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22931418		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22931418		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	31379142	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	10233905		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	30099546		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	22747566, 23553616		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	29849884	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30761998		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31439521		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17515454, 29229746, 31280647, 31787052		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	37686882	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	24520084	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27402919, 31165592, 31743815		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24931457		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	27637085		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23266545, 30761998		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	24520084	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21915726, 30445007		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	27108801	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	19339556	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18281478		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27108801, 29849884	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28242713		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28242713		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28242713		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28242713		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29849884		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29849884		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18281478, 28578013, 30890751		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27637085		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22931418, 23225414		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29872318		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19431059, 22931418, 28578013, 31083324, 31172474, 31172487		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31250671		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	22366799		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30663266, 31661145		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11762710, 19431059, 29849884		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31172487		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31756344		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19208736		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	31790890		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22931418, 23225414		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24802997		★☆☆☆☆ Found in Text Mining only
Psychomotor Disorders	Psychiatric disorders	Pubtator	30375286	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27402919		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	24802997		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29802697	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31443700		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29872318		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30226391		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	20407074		★☆☆☆☆ Found in Text Mining only
Thyroid Dysgenesis	Thyroid Dysgenesis	BEFREE	28666341		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25848056		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25848056	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31706280	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30226391		★☆☆☆☆ Found in Text Mining only