Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	53834
Gene name	Fibroblast growth factor receptor like 1
Gene symbol	FGFRL1
Synonyms (NCBI Gene)	FGFR-5FGFR5FHFR
Chromosome	4
Chromosome location	4p16.3
Summary	The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affini

165

Show/Hide all (165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000153	hsa-miR-210-3p	Luciferase reporter assay	19782034
MIRT000153	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21044961
MIRT000153	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21044961
MIRT018248	hsa-miR-335-5p	Microarray	18185580
MIRT052346	hsa-let-7b-5p	CLASH	23622248
MIRT329256	hsa-miR-4310	PAR-CLIP	21572407
MIRT329261	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT545443	hsa-miR-3130-3p	PAR-CLIP	21572407
MIRT545442	hsa-miR-4793-3p	PAR-CLIP	21572407
MIRT329255	hsa-miR-1827	PAR-CLIP	21572407
MIRT329252	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT329257	hsa-miR-3659	PAR-CLIP	21572407
MIRT163941	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT163942	hsa-miR-107	PAR-CLIP	21572407
MIRT121075	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT545441	hsa-miR-6765-5p	PAR-CLIP	21572407
MIRT329258	hsa-miR-4658	PAR-CLIP	21572407
MIRT329260	hsa-miR-6790-5p	PAR-CLIP	21572407
MIRT121074	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT329254	hsa-miR-1304-5p	PAR-CLIP	21572407
MIRT000153	hsa-miR-210-3p	HITS-CLIP	22473208
MIRT163939	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT000153	hsa-miR-210-3p	HITS-CLIP	22473208
MIRT163939	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT329256	hsa-miR-4310	PAR-CLIP	21572407
MIRT329261	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT545443	hsa-miR-3130-3p	PAR-CLIP	21572407
MIRT545442	hsa-miR-4793-3p	PAR-CLIP	21572407
MIRT329255	hsa-miR-1827	PAR-CLIP	21572407
MIRT329252	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT329257	hsa-miR-3659	PAR-CLIP	21572407
MIRT163941	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT163942	hsa-miR-107	PAR-CLIP	21572407
MIRT121075	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT545441	hsa-miR-6765-5p	PAR-CLIP	21572407
MIRT329258	hsa-miR-4658	PAR-CLIP	21572407
MIRT329260	hsa-miR-6790-5p	PAR-CLIP	21572407
MIRT121074	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT329254	hsa-miR-1304-5p	PAR-CLIP	21572407
MIRT996232	hsa-miR-4514	CLIP-seq
MIRT996233	hsa-miR-4645-5p	CLIP-seq
MIRT996234	hsa-miR-4669	CLIP-seq
MIRT996235	hsa-miR-4673	CLIP-seq
MIRT996236	hsa-miR-4692	CLIP-seq
MIRT996237	hsa-miR-595	CLIP-seq
MIRT996238	hsa-miR-103a	CLIP-seq
MIRT996239	hsa-miR-1231	CLIP-seq
MIRT996240	hsa-miR-1285	CLIP-seq
MIRT996241	hsa-miR-1299	CLIP-seq
MIRT996242	hsa-miR-1343	CLIP-seq
MIRT996243	hsa-miR-140-3p	CLIP-seq
MIRT996244	hsa-miR-150	CLIP-seq
MIRT996245	hsa-miR-185	CLIP-seq
MIRT996246	hsa-miR-198	CLIP-seq
MIRT996247	hsa-miR-21	CLIP-seq
MIRT996248	hsa-miR-210	CLIP-seq
MIRT996249	hsa-miR-296-5p	CLIP-seq
MIRT996250	hsa-miR-3187-5p	CLIP-seq
MIRT996251	hsa-miR-3621	CLIP-seq
MIRT996252	hsa-miR-3657	CLIP-seq
MIRT996253	hsa-miR-3665	CLIP-seq
MIRT996254	hsa-miR-3687	CLIP-seq
MIRT996255	hsa-miR-3688-5p	CLIP-seq
MIRT996256	hsa-miR-3713	CLIP-seq
MIRT996257	hsa-miR-3714	CLIP-seq
MIRT996258	hsa-miR-3937	CLIP-seq
MIRT996259	hsa-miR-4281	CLIP-seq
MIRT996260	hsa-miR-4306	CLIP-seq
MIRT996261	hsa-miR-4313	CLIP-seq
MIRT996262	hsa-miR-4442	CLIP-seq
MIRT996263	hsa-miR-4449	CLIP-seq
MIRT996264	hsa-miR-4470	CLIP-seq
MIRT996232	hsa-miR-4514	CLIP-seq
MIRT996265	hsa-miR-4520a-5p	CLIP-seq
MIRT996266	hsa-miR-4520b-5p	CLIP-seq
MIRT996267	hsa-miR-4532	CLIP-seq
MIRT996268	hsa-miR-4644	CLIP-seq
MIRT996233	hsa-miR-4645-5p	CLIP-seq
MIRT996269	hsa-miR-4652-5p	CLIP-seq
MIRT996234	hsa-miR-4669	CLIP-seq
MIRT996235	hsa-miR-4673	CLIP-seq
MIRT996270	hsa-miR-4686	CLIP-seq
MIRT996271	hsa-miR-4690-3p	CLIP-seq
MIRT996236	hsa-miR-4692	CLIP-seq
MIRT996272	hsa-miR-4711-3p	CLIP-seq
MIRT996273	hsa-miR-4736	CLIP-seq
MIRT996274	hsa-miR-4768-3p	CLIP-seq
MIRT996275	hsa-miR-4786-5p	CLIP-seq
MIRT996276	hsa-miR-517b	CLIP-seq
MIRT996277	hsa-miR-590-5p	CLIP-seq
MIRT996278	hsa-miR-593	CLIP-seq
MIRT996237	hsa-miR-595	CLIP-seq
MIRT996279	hsa-miR-612	CLIP-seq
MIRT996280	hsa-miR-622	CLIP-seq
MIRT996281	hsa-miR-665	CLIP-seq
MIRT996282	hsa-miR-875-3p	CLIP-seq
MIRT996283	hsa-miR-940	CLIP-seq
MIRT996246	hsa-miR-198	CLIP-seq
MIRT996238	hsa-miR-103a	CLIP-seq
MIRT996239	hsa-miR-1231	CLIP-seq
MIRT1995379	hsa-miR-1304	CLIP-seq
MIRT996246	hsa-miR-198	CLIP-seq
MIRT996248	hsa-miR-210	CLIP-seq
MIRT996252	hsa-miR-3657	CLIP-seq
MIRT996254	hsa-miR-3687	CLIP-seq
MIRT996256	hsa-miR-3713	CLIP-seq
MIRT996262	hsa-miR-4442	CLIP-seq
MIRT996232	hsa-miR-4514	CLIP-seq
MIRT996265	hsa-miR-4520a-5p	CLIP-seq
MIRT996266	hsa-miR-4520b-5p	CLIP-seq
MIRT996233	hsa-miR-4645-5p	CLIP-seq
MIRT996234	hsa-miR-4669	CLIP-seq
MIRT996235	hsa-miR-4673	CLIP-seq
MIRT996270	hsa-miR-4686	CLIP-seq
MIRT996236	hsa-miR-4692	CLIP-seq
MIRT1995380	hsa-miR-4742-5p	CLIP-seq
MIRT996237	hsa-miR-595	CLIP-seq
MIRT996280	hsa-miR-622	CLIP-seq
MIRT996238	hsa-miR-103a	CLIP-seq
MIRT1995379	hsa-miR-1304	CLIP-seq
MIRT2229444	hsa-miR-134	CLIP-seq
MIRT2229445	hsa-miR-1973	CLIP-seq
MIRT996246	hsa-miR-198	CLIP-seq
MIRT2229446	hsa-miR-3118	CLIP-seq
MIRT2229447	hsa-miR-3164	CLIP-seq
MIRT996252	hsa-miR-3657	CLIP-seq
MIRT996257	hsa-miR-3714	CLIP-seq
MIRT2229448	hsa-miR-3922-5p	CLIP-seq
MIRT996232	hsa-miR-4514	CLIP-seq
MIRT996233	hsa-miR-4645-5p	CLIP-seq
MIRT996234	hsa-miR-4669	CLIP-seq
MIRT996235	hsa-miR-4673	CLIP-seq
MIRT996270	hsa-miR-4686	CLIP-seq
MIRT996236	hsa-miR-4692	CLIP-seq
MIRT2229449	hsa-miR-4800-3p	CLIP-seq
MIRT996276	hsa-miR-517b	CLIP-seq
MIRT2229450	hsa-miR-592	CLIP-seq
MIRT2229451	hsa-miR-597	CLIP-seq
MIRT2229452	hsa-miR-3163	CLIP-seq
MIRT996238	hsa-miR-103a	CLIP-seq
MIRT996232	hsa-miR-4514	CLIP-seq
MIRT996236	hsa-miR-4692	CLIP-seq
MIRT2533341	hsa-miR-1275	CLIP-seq
MIRT2533342	hsa-miR-1908	CLIP-seq
MIRT2533343	hsa-miR-2114	CLIP-seq
MIRT2533344	hsa-miR-3153	CLIP-seq
MIRT2533345	hsa-miR-3197	CLIP-seq
MIRT2533346	hsa-miR-4259	CLIP-seq
MIRT2533347	hsa-miR-4525	CLIP-seq
MIRT2533348	hsa-miR-4665-5p	CLIP-seq
MIRT2533349	hsa-miR-4706	CLIP-seq
MIRT2533350	hsa-miR-4723-5p	CLIP-seq
MIRT2533351	hsa-miR-4749-5p	CLIP-seq
MIRT2533352	hsa-miR-556-5p	CLIP-seq
MIRT2533353	hsa-miR-571	CLIP-seq
MIRT2533354	hsa-miR-625	CLIP-seq
MIRT2533355	hsa-miR-663	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	IEA
GO:0003179	Process	Heart valve morphogenesis	IEA
GO:0005007	Function	Fibroblast growth factor receptor activity	IBA
GO:0005007	Function	Fibroblast growth factor receptor activity	IDA	12813049
GO:0005007	Function	Fibroblast growth factor receptor activity	IEA
GO:0005794	Component	Golgi apparatus	IDA	18061161
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12813049, 18061161
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0008201	Function	Heparin binding	IDA	12813049
GO:0008201	Function	Heparin binding	IMP	18061161
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0017134	Function	Fibroblast growth factor binding	IBA
GO:0017134	Function	Fibroblast growth factor binding	IEA
GO:0030133	Component	Transport vesicle	IDA	18061161
GO:0042802	Function	Identical protein binding	IPI	18061161
GO:0044291	Component	Cell-cell contact zone	IDA	18061161
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060539	Process	Diaphragm development	IEA
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IMP	18061161

MIM	HGNC	e!Ensembl
605830	3693	ENSG00000127418

Q8N441

Protein name

Fibroblast growth factor receptor-like 1 (FGF receptor-like protein 1) (FGF homologous factor receptor) (FGFR-like protein) (Fibroblast growth factor receptor 5) (FGFR-5)

Protein function

Has a negative effect on cell proliferation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07679	I-set	29 → 116	Immunoglobulin I-set domain	Domain
PF07679	I-set	147 → 238	Immunoglobulin I-set domain	Domain
PF13927	Ig_3	245 → 342		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed preferentially in cartilaginous tissues and pancreas. Highly expressed in the liver, kidney, heart, brain and skeletal muscle. Weakly expressed in the lung, small intestine and spleen. {ECO:0000269|PubMed:11031111, ECO:000026

Sequence

MTPSPLLLLLLPPLLLGAFPPAAAARGPPKMADKVVPRQVARLGRTVRLQCPVEGDPPPL
TMWTKDGRTIHSGWSRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDI
SPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRP
DITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQ
RTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGG
QKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPK
PPGPPVASSSSATSLPWPVVIGIPAGAVFILGTLLLWLCQAQKKPCTPAPAPPLPGHRPP
GTARDRSGDKDLPSLAALSAGPGVGLCEEHGSPAAPQHLLGPGPVAGPKLYPKLYTDIHT
HTHTHSHTHSHVEGKVHQHIHYQC

Sequence length

504

Interactions

View interactions

	Reactome
			FGFRL1 modulation of FGFR1 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
4p partial monosomy syndrome	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital diaphragmatic hernia	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
FGFRL1-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Flexion contracture	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WOLF-HIRSCHHORN SYNDROME	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (72)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Absence of septum pellucidum	Absence Of Septum Pellucidum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23775577, 28861329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	31396565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24548884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23775577, 28861329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34061869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29675438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	29241927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft palate and bilateral cleft lip	Cleft Palate And Bilateral Cleft Lip	BEFREE	29241927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25193853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	20024584		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	CTD_human_DG	20938900		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Congenital ectopic pupil	Congenital anomaly of eye	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital fusion of ribs	Rib fusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Bochdalek	Posterolateral diaphragmatic hernia	CTD_human_DG	20938900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Morgagni	Morgagni diaphragmatic hernia	CTD_human_DG	20938900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	19056490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37116156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21044961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	29241927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	Pubtator	32163230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	29675438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	35980984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27666683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32396269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29371906, 32396269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24548884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29675438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23775577, 28861329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16273302, 21044961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16273302, 23775577, 29675438, 29963148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28211912	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	35980984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30008923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	29675438		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16273302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23571109, 26015570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37130628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pitt-Rogers-Danks Syndrome	Pitt-Rogers-Danks Syndrome	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37929340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Radioulnar Synostosis	Radioulnar Synostosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rieger eye malformation sequence	Axenfeld anomaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rieger syndrome	Rieger syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24719266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29963148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21044961, 29963148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stenosis of external auditory canal	Stenosis Of External Auditory Canal	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stereotyped Behavior	Stereotyped Behavior	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23775577	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolf-Hirschhorn Syndrome	Wolf-Hirschhorn Syndrome	BEFREE	29241927		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wolf-Hirschhorn Syndrome	Wolf-Hirschhorn Syndrome	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

FGFRL1 (fibroblast growth factor receptor like 1)