IL20RB (interleukin 20 receptor subunit beta)

Gene

• Entrez ID: 53833
• Gene name: Interleukin 20 receptor subunit beta
• Gene symbol: IL20RB
• Synonyms (NCBI Gene): DIRS1, FNDC6, IL-20R-beta, IL-20R2, IL-20RB
• Chromosome: 3
• Chromosome location: 3q22.3
• Summary: IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).[supplied by OMIM, Feb 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT714139	hsa-miR-224-5p	HITS-CLIP	19536157
MIRT714138	hsa-miR-5003-3p	HITS-CLIP	19536157
MIRT714137	hsa-miR-296-3p	HITS-CLIP	19536157
MIRT714136	hsa-miR-6823-5p	HITS-CLIP	19536157
MIRT714135	hsa-miR-6840-3p	HITS-CLIP	19536157
MIRT714134	hsa-miR-1915-3p	HITS-CLIP	19536157
MIRT714133	hsa-miR-6764-5p	HITS-CLIP	19536157
MIRT714132	hsa-miR-4726-3p	HITS-CLIP	19536157
MIRT714131	hsa-miR-5187-5p	HITS-CLIP	19536157
MIRT714130	hsa-miR-7977	HITS-CLIP	19536157
MIRT714129	hsa-miR-4446-5p	HITS-CLIP	19536157
MIRT483899	hsa-miR-1183	PAR-CLIP	20371350
MIRT483898	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT483897	hsa-miR-4494	PAR-CLIP	20371350
MIRT483896	hsa-miR-499b-5p	PAR-CLIP	20371350
MIRT483895	hsa-miR-4704-3p	PAR-CLIP	20371350
MIRT483893	hsa-miR-5187-3p	PAR-CLIP	20371350
MIRT483894	hsa-miR-15b-3p	PAR-CLIP	20371350
MIRT483892	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT483891	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT544829	hsa-miR-6879-3p	PAR-CLIP	20371350
MIRT489323	hsa-miR-597-5p	PAR-CLIP	20371350
MIRT483890	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT483899	hsa-miR-1183	PAR-CLIP	21572407
MIRT483898	hsa-miR-5586-3p	PAR-CLIP	21572407
MIRT483897	hsa-miR-4494	PAR-CLIP	21572407
MIRT483896	hsa-miR-499b-5p	PAR-CLIP	21572407
MIRT483895	hsa-miR-4704-3p	PAR-CLIP	21572407
MIRT483893	hsa-miR-5187-3p	PAR-CLIP	21572407
MIRT483894	hsa-miR-15b-3p	PAR-CLIP	21572407
MIRT483892	hsa-miR-6832-5p	PAR-CLIP	21572407
MIRT483891	hsa-miR-4732-5p	PAR-CLIP	21572407
MIRT544829	hsa-miR-6879-3p	PAR-CLIP	21572407
MIRT489323	hsa-miR-597-5p	PAR-CLIP	21572407
MIRT483890	hsa-miR-7161-5p	PAR-CLIP	21572407
MIRT513082	hsa-miR-603	PAR-CLIP	21572407
MIRT513078	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT513081	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT513080	hsa-miR-6760-3p	PAR-CLIP	21572407
MIRT513079	hsa-miR-8064	PAR-CLIP	21572407
MIRT513076	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT513078	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT513077	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT513076	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT513082	hsa-miR-603	PAR-CLIP	22012620
MIRT513078	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT513081	hsa-miR-144-3p	PAR-CLIP	22012620
MIRT513080	hsa-miR-6760-3p	PAR-CLIP	22012620
MIRT513079	hsa-miR-8064	PAR-CLIP	22012620
MIRT513076	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT513078	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT513077	hsa-miR-582-5p	PAR-CLIP	22012620
MIRT513076	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT513082	hsa-miR-603	PAR-CLIP	23446348
MIRT513078	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT513081	hsa-miR-144-3p	PAR-CLIP	23446348
MIRT513080	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT513079	hsa-miR-8064	PAR-CLIP	23446348
MIRT513076	hsa-miR-505-3p	PAR-CLIP	23446348
MIRT513078	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT513077	hsa-miR-582-5p	PAR-CLIP	23446348
MIRT513076	hsa-miR-505-3p	PAR-CLIP	23446348
MIRT483899	hsa-miR-1183	PAR-CLIP	23592263
MIRT483898	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT483897	hsa-miR-4494	PAR-CLIP	23592263
MIRT483896	hsa-miR-499b-5p	PAR-CLIP	23592263
MIRT483895	hsa-miR-4704-3p	PAR-CLIP	23592263
MIRT483893	hsa-miR-5187-3p	PAR-CLIP	23592263
MIRT483894	hsa-miR-15b-3p	PAR-CLIP	23592263
MIRT483892	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT483891	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT489323	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT483890	hsa-miR-7161-5p	PAR-CLIP	23592263
MIRT483899	hsa-miR-1183	PAR-CLIP	23592263
MIRT483898	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT483897	hsa-miR-4494	PAR-CLIP	23592263
MIRT483896	hsa-miR-499b-5p	PAR-CLIP	23592263
MIRT483895	hsa-miR-4704-3p	PAR-CLIP	23592263
MIRT483893	hsa-miR-5187-3p	PAR-CLIP	23592263
MIRT483894	hsa-miR-15b-3p	PAR-CLIP	23592263
MIRT483892	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT483891	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT483890	hsa-miR-7161-5p	PAR-CLIP	23592263
MIRT714139	hsa-miR-224-5p	HITS-CLIP	19536157
MIRT714138	hsa-miR-5003-3p	HITS-CLIP	19536157
MIRT714137	hsa-miR-296-3p	HITS-CLIP	19536157
MIRT714136	hsa-miR-6823-5p	HITS-CLIP	19536157
MIRT714135	hsa-miR-6840-3p	HITS-CLIP	19536157
MIRT714134	hsa-miR-1915-3p	HITS-CLIP	19536157
MIRT714133	hsa-miR-6764-5p	HITS-CLIP	19536157
MIRT714132	hsa-miR-4726-3p	HITS-CLIP	19536157
MIRT714131	hsa-miR-5187-5p	HITS-CLIP	19536157
MIRT714130	hsa-miR-7977	HITS-CLIP	19536157
MIRT714129	hsa-miR-4446-5p	HITS-CLIP	19536157
MIRT483899	hsa-miR-1183	PAR-CLIP	20371350
MIRT483898	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT483897	hsa-miR-4494	PAR-CLIP	20371350
MIRT483896	hsa-miR-499b-5p	PAR-CLIP	20371350
MIRT483895	hsa-miR-4704-3p	PAR-CLIP	20371350
MIRT483893	hsa-miR-5187-3p	PAR-CLIP	20371350
MIRT483894	hsa-miR-15b-3p	PAR-CLIP	20371350
MIRT483892	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT483891	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT544829	hsa-miR-6879-3p	PAR-CLIP	20371350
MIRT489323	hsa-miR-597-5p	PAR-CLIP	20371350
MIRT483890	hsa-miR-7161-5p	PAR-CLIP	20371350
MIRT483899	hsa-miR-1183	PAR-CLIP	21572407
MIRT483898	hsa-miR-5586-3p	PAR-CLIP	21572407
MIRT483897	hsa-miR-4494	PAR-CLIP	21572407
MIRT483896	hsa-miR-499b-5p	PAR-CLIP	21572407
MIRT483895	hsa-miR-4704-3p	PAR-CLIP	21572407
MIRT483893	hsa-miR-5187-3p	PAR-CLIP	21572407
MIRT483894	hsa-miR-15b-3p	PAR-CLIP	21572407
MIRT483892	hsa-miR-6832-5p	PAR-CLIP	21572407
MIRT483891	hsa-miR-4732-5p	PAR-CLIP	21572407
MIRT544829	hsa-miR-6879-3p	PAR-CLIP	21572407
MIRT489323	hsa-miR-597-5p	PAR-CLIP	21572407
MIRT483890	hsa-miR-7161-5p	PAR-CLIP	21572407
MIRT513082	hsa-miR-603	PAR-CLIP	21572407
MIRT513078	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT513081	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT513080	hsa-miR-6760-3p	PAR-CLIP	21572407
MIRT513079	hsa-miR-8064	PAR-CLIP	21572407
MIRT513076	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT513078	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT513077	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT513076	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT513082	hsa-miR-603	PAR-CLIP	22012620
MIRT513078	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT513081	hsa-miR-144-3p	PAR-CLIP	22012620
MIRT513080	hsa-miR-6760-3p	PAR-CLIP	22012620
MIRT513079	hsa-miR-8064	PAR-CLIP	22012620
MIRT513076	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT513078	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT513077	hsa-miR-582-5p	PAR-CLIP	22012620
MIRT513076	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT513082	hsa-miR-603	PAR-CLIP	23446348
MIRT513078	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT513081	hsa-miR-144-3p	PAR-CLIP	23446348
MIRT513080	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT513079	hsa-miR-8064	PAR-CLIP	23446348
MIRT513076	hsa-miR-505-3p	PAR-CLIP	23446348
MIRT513078	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT513077	hsa-miR-582-5p	PAR-CLIP	23446348
MIRT513076	hsa-miR-505-3p	PAR-CLIP	23446348
MIRT483899	hsa-miR-1183	PAR-CLIP	23592263
MIRT483898	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT483897	hsa-miR-4494	PAR-CLIP	23592263
MIRT483896	hsa-miR-499b-5p	PAR-CLIP	23592263
MIRT483895	hsa-miR-4704-3p	PAR-CLIP	23592263
MIRT483893	hsa-miR-5187-3p	PAR-CLIP	23592263
MIRT483894	hsa-miR-15b-3p	PAR-CLIP	23592263
MIRT483892	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT483891	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT489323	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT483890	hsa-miR-7161-5p	PAR-CLIP	23592263
MIRT483899	hsa-miR-1183	PAR-CLIP	23592263
MIRT483898	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT483897	hsa-miR-4494	PAR-CLIP	23592263
MIRT483896	hsa-miR-499b-5p	PAR-CLIP	23592263
MIRT483895	hsa-miR-4704-3p	PAR-CLIP	23592263
MIRT483893	hsa-miR-5187-3p	PAR-CLIP	23592263
MIRT483894	hsa-miR-15b-3p	PAR-CLIP	23592263
MIRT483892	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT483891	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT483890	hsa-miR-7161-5p	PAR-CLIP	23592263
MIRT1064509	hsa-miR-101	CLIP-seq
MIRT1064510	hsa-miR-144	CLIP-seq
MIRT1064511	hsa-miR-3065-5p	CLIP-seq
MIRT1064512	hsa-miR-3686	CLIP-seq
MIRT1064513	hsa-miR-495	CLIP-seq
MIRT1064514	hsa-miR-505	CLIP-seq
MIRT1064515	hsa-miR-544	CLIP-seq
MIRT1064516	hsa-miR-617	CLIP-seq
MIRT2247672	hsa-miR-4691-5p	CLIP-seq
MIRT2247673	hsa-miR-4778-5p	CLIP-seq
MIRT2451742	hsa-miR-1245b-3p	CLIP-seq
MIRT2451743	hsa-miR-361-3p	CLIP-seq
MIRT2451744	hsa-miR-3679-3p	CLIP-seq
MIRT2451745	hsa-miR-539	CLIP-seq
MIRT2451746	hsa-miR-885-5p	CLIP-seq
MIRT2551103	hsa-miR-1251	CLIP-seq
MIRT2551104	hsa-miR-3614-3p	CLIP-seq
MIRT2551105	hsa-miR-4755-5p	CLIP-seq
MIRT2551106	hsa-miR-642a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001808	Process	Negative regulation of type IV hypersensitivity	IEA
GO:0002437	Process	Inflammatory response to antigenic stimulus	IEA
GO:0002765	Process	Immune response-inhibiting signal transduction	IEA
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	22802649, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0042015	Function	Interleukin-20 binding	IBA
GO:0042015	Function	Interleukin-20 binding	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050863	Process	Regulation of T cell activation	IEA
GO:0160165	Process	CD8-positive, alpha-beta T cell homeostasis	IEA

Other IDs

• MIM: 605621
• HGNC: 6004
• e!Ensembl: ENSG00000174564

Protein

• UniProt ID: Q6UXL0
• Protein name: Interleukin-20 receptor subunit beta (IL-20 receptor subunit beta) (IL-20R-beta) (IL-20RB) (Fibronectin type III domain containing 6) (FNDC6) (IL-20R2)
• Protein function: The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.
• PDB: 4DOH, 6DF3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01108	Tissue_fac	15 → 124	Tissue factor	Family
  PF09294	Interfer-bind	136 → 227	Interferon-alpha/beta receptor, fibronectin type III	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with highest levels in skin and testis. Highly expressed in psoriatic skin. {ECO:0000269|PubMed:11163236}.
• Sequence:

  MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAP
  GETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQ
  TSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHV
  KMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAF
  VGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVM
  SPEELLRAWIS

• Sequence length: 311

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
JAK-STAT signaling pathway

Reactome:

Interleukin-20 family signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLONAL HEMATOPOIESIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE-NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20061404		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	37854191	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31489573, 35883015, 39247556	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35299868	Stimulate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31489573		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	24455976	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	26903709		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	24455976	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	24455976, 26903709		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36006737	Stimulate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24434574		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36553569	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16645593	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35008743	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21565488		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33253517, 34143198, 38098005	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17074928, 18480827		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	18480827		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27619991		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	20699607		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	20699607		★☆☆☆☆ Found in Text Mining only