Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	53832
Gene name	Interleukin 20 receptor subunit alpha
Gene symbol	IL20RA
Synonyms (NCBI Gene)	CRF2-8IL-20R-alphaIL-20R1IL-20RA
Chromosome	6
Chromosome location	6q23.3
Summary	This gene encodes a member of the type II cytokine receptor family. The encoded protein is a subunit of the receptor for interleukin 20, a cytokine that may be involved in epidermal function. The interleukin 20 receptor is a heterodimeric complex consisti

Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029093	hsa-miR-26b-5p	Microarray	19088304
MIRT1064490	hsa-miR-1236	CLIP-seq
MIRT1064491	hsa-miR-1262	CLIP-seq
MIRT1064492	hsa-miR-2054	CLIP-seq
MIRT1064493	hsa-miR-3115	CLIP-seq
MIRT1064494	hsa-miR-3180-5p	CLIP-seq
MIRT1064495	hsa-miR-3675-3p	CLIP-seq
MIRT1064496	hsa-miR-3689a-5p	CLIP-seq
MIRT1064497	hsa-miR-3689b	CLIP-seq
MIRT1064498	hsa-miR-3689e	CLIP-seq
MIRT1064499	hsa-miR-3689f	CLIP-seq
MIRT1064500	hsa-miR-380	CLIP-seq
MIRT1064501	hsa-miR-4289	CLIP-seq
MIRT1064502	hsa-miR-4307	CLIP-seq
MIRT1064503	hsa-miR-4636	CLIP-seq
MIRT1064504	hsa-miR-4701-3p	CLIP-seq
MIRT1064505	hsa-miR-508-5p	CLIP-seq
MIRT1064506	hsa-miR-520a-5p	CLIP-seq
MIRT1064507	hsa-miR-525-5p	CLIP-seq
MIRT1064508	hsa-miR-942	CLIP-seq
MIRT1550115	hsa-miR-3171	CLIP-seq
MIRT1550116	hsa-miR-493	CLIP-seq
MIRT1550117	hsa-miR-550a	CLIP-seq
MIRT1550118	hsa-miR-630	CLIP-seq
MIRT1064505	hsa-miR-508-5p	CLIP-seq
MIRT2015339	hsa-miR-580	CLIP-seq
MIRT1550115	hsa-miR-3171	CLIP-seq
MIRT1550116	hsa-miR-493	CLIP-seq
MIRT1550117	hsa-miR-550a	CLIP-seq
MIRT1550118	hsa-miR-630	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	22802649
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0042015	Function	Interleukin-20 binding	IBA
GO:0042015	Function	Interleukin-20 binding	IEA
GO:0045124	Process	Regulation of bone resorption	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
605620	6003	ENSG00000016402

Q9UHF4

Protein name

Interleukin-20 receptor subunit alpha (IL-20 receptor subunit alpha) (IL-20R-alpha) (IL-20RA) (Cytokine receptor class-II member 8) (Cytokine receptor family 2 member 8) (CRF2-8) (IL-20R1) (ZcytoR7)

Protein function

The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26.

PDB

4DOH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01108	Tissue_fac	14 → 123	Tissue factor	Family
PF09294	Interfer-bind	135 → 240	Interferon-alpha/beta receptor, fibronectin type III	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin. {ECO:0000269|PubMed:11163236, ECO:0000269|PubMed:14764663}.

Sequence

MRAPGRPALRPLPLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPE
GLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKC
SKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLK
YNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTL
KDQSSEFKAKIIFWYVLPVSITVFLFSVMGYSIYRYIHVGKEKHPANLILIYGNEFDKRF
FVPAEKIVINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLRPPQEEEEVKHL
GYASHLMEIFCDSEENTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTDICAGPEEQELS
LQEEVSTQGTLLESQAALAVLGPQTLQYSYTPQLQDLDPLAQEHTDSEEGPEEEPSTTLV
DWDPQTGRLCIPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDRPPGENETYLMQ
FMEEWGLYVQMEN

Sequence length

553

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor JAK-STAT signaling pathway		Interleukin-20 family signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSIENT ISCHEMIC ATTACK	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31831038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31114590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29483615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23468528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16710719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	23929435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31426584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31831038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28360429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28360429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27655316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19017733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23468528		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24434574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16645593	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18339850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21565488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29892294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	18480827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	18480827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31831038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23271730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	20699607		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	20699607		★★★★★ ★☆☆☆☆ Found in Text Mining only

IL20RA (interleukin 20 receptor subunit alpha)