Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	53828
Gene name	FXYD domain containing ion transport regulator 4
Gene symbol	FXYD4
Synonyms (NCBI Gene)	CHIF
Chromosome	10
Chromosome location	10q11.21
Summary	This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature f

Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019195	hsa-miR-335-5p	Microarray	18185580
MIRT1998509	hsa-miR-1915	CLIP-seq
MIRT1998510	hsa-miR-3689d	CLIP-seq
MIRT1998511	hsa-miR-4488	CLIP-seq
MIRT1998512	hsa-miR-4640-5p	CLIP-seq
MIRT1998513	hsa-miR-4697-5p	CLIP-seq
MIRT1998514	hsa-miR-4726-5p	CLIP-seq
MIRT1998515	hsa-miR-4731-5p	CLIP-seq
MIRT1998516	hsa-miR-637	CLIP-seq
MIRT1998517	hsa-miR-765	CLIP-seq
MIRT2232224	hsa-miR-1258	CLIP-seq
MIRT2232225	hsa-miR-199a-5p	CLIP-seq
MIRT2232226	hsa-miR-199b-5p	CLIP-seq
MIRT2232227	hsa-miR-3152-3p	CLIP-seq
MIRT1998510	hsa-miR-3689d	CLIP-seq
MIRT1998511	hsa-miR-4488	CLIP-seq
MIRT1998512	hsa-miR-4640-5p	CLIP-seq
MIRT1998513	hsa-miR-4697-5p	CLIP-seq
MIRT1998514	hsa-miR-4726-5p	CLIP-seq
MIRT1998515	hsa-miR-4731-5p	CLIP-seq
MIRT1998516	hsa-miR-637	CLIP-seq
MIRT1998509	hsa-miR-1915	CLIP-seq
MIRT1998510	hsa-miR-3689d	CLIP-seq
MIRT1998511	hsa-miR-4488	CLIP-seq
MIRT1998512	hsa-miR-4640-5p	CLIP-seq
MIRT1998513	hsa-miR-4697-5p	CLIP-seq
MIRT1998514	hsa-miR-4726-5p	CLIP-seq
MIRT1998515	hsa-miR-4731-5p	CLIP-seq
MIRT1998516	hsa-miR-637	CLIP-seq
MIRT1998517	hsa-miR-765	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	ISS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0017080	Function	Sodium channel regulator activity	IBA
GO:0017080	Function	Sodium channel regulator activity	ISS
GO:0043269	Process	Regulation of monoatomic ion transport	IEA
GO:0051117	Function	ATPase binding	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0099106	Function	Ion channel regulator activity	IEA
GO:1903278	Process	Positive regulation of sodium ion export across plasma membrane	IBA

MIM	HGNC	e!Ensembl
616926	4028	ENSG00000150201

P59646

Protein name

FXYD domain-containing ion transport regulator 4

Protein function

Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane (By similarity). Increases the apparen

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02038	ATP1G1_PLM_MAT8	25 → 71	ATP1G1/PLM/MAT8 family	Family

Sequence

MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGK
CKCKSSQKQHSPVPEKAIPLITPGSATTC

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Aldosterone-regulated sodium reabsorption		Ion homeostasis Ion transport by P-type ATPases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIRSCHSPRUNG DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26831905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34270462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34238116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FXYD4 (FXYD domain containing ion transport regulator 4)