Gene Gene information from NCBI Gene database.
Entrez ID 5371
Gene name PML nuclear body scaffold
Gene symbol PML
Synonyms (NCBI Gene)
MYLPP8675RNF71TRIM19
Chromosome 15
Chromosome location 15q24.1
Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies wh
miRNA miRNA information provided by mirtarbase database.
165
miRTarBase ID miRNA Experiments Reference
MIRT018318 hsa-miR-335-5p Microarray 18185580
MIRT043919 hsa-miR-378a-3p CLASH 23622248
MIRT042535 hsa-miR-423-3p CLASH 23622248
MIRT042535 hsa-miR-423-3p CLASH 23622248
MIRT1244408 hsa-miR-1227 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
7
Transcription factor Regulation Reference
ARID3A Activation 22010578
IRF9 Activation 8681971
PML Activation 15529177
STAT1 Activation 21115099;22589541
STAT1 Unknown 15519999
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
146
GO ID Ontology Definition Evidence Reference
GO:0000781 Component Chromosome, telomeric region IDA 26119943
GO:0001666 Process Response to hypoxia IDA 16915281
GO:0001666 Process Response to hypoxia IEA
GO:0001666 Process Response to hypoxia IEA
GO:0002230 Process Positive regulation of defense response to virus by host IMP 16873256, 16873257
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
102578 9113 ENSG00000140464
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P29590
Protein name Protein PML (E3 SUMO-protein ligase PML) (EC 2.3.2.-) (Promyelocytic leukemia protein) (RING finger protein 71) (RING-type E3 SUMO transferase PML) (Tripartite motif-containing protein 19) (TRIM19)
Protein function Functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms. A
PDB 1BOR , 2MVW , 2MWX , 4WJN , 4WJO , 5YUF , 6IMQ , 6UYO , 6UYP , 6UYQ , 6UYR , 6UYS , 6UYT , 6UYU , 6UYV , 8DJH , 8DJI , 8J25 , 8J2P , 8YTC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00643 zf-B_box 124 166 B-box zinc finger Domain
PF12126 DUF3583 240 570 Protein of unknown function (DUF3583) Family
Sequence
MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC
QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR
QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG
TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL
DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA
VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR
QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS
QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP
NSNHVASGAGEAEERVVVISSSEDSDAENS
SSRELDDSSSESSDLQLEGPSTLRVLDENL
ADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQ
HFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPG
ASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFAS
LQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPA
FNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS
Sequence length 882
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Ubiquitin mediated proteolysis
Endocytosis
Influenza A
Herpes simplex virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
  SUMOylation of DNA damage response and repair proteins
SUMOylation of ubiquitinylation proteins
Regulation of TP53 Activity through Acetylation
Interferon gamma signaling
Regulation of RUNX1 Expression and Activity
Regulation of PTEN localization
HCMV Early Events
Transcriptional regulation of granulopoiesis
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
15
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Breast ductal adenocarcinoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DYSLIPIDEMIAS CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
15q24 Microdeletion 15q24 Microdeletion BEFREE 22296450
★☆☆☆☆
Found in Text Mining only
Acute Erythroblastic Leukemia Erythroblastic Leukemia BEFREE 7529139
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 10679814
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 15820957, 24886876, 8152281, 9372085
★☆☆☆☆
Found in Text Mining only
Acute Megakaryocytic Leukemias Megakaryocytic Leukemia BEFREE 15226186, 22296450
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 20362228, 24449212, 28767575
★☆☆☆☆
Found in Text Mining only
Acute Myeloid Leukemia, M1 Myeloid Leukemia BEFREE 12888896
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 10233384, 10329918, 10339585, 10360373, 10373566, 10498592, 10553155, 10564584, 10597230, 10601023, 10611345, 10627441, 10637504, 10669754, 10673752
View all (475 more)
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia CTD_human_DG 10742073, 14706140, 16788101, 16835227, 16891316, 16935935, 17294898, 17649720, 19029980, 19035177, 19884644, 19887701, 21345080, 21613260, 22213200
View all (5 more)
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia ORPHANET_DG 10942371
★☆☆☆☆
Found in Text Mining only