Gene Gene information from NCBI Gene database.
Entrez ID 5368
Gene name Prepronociceptin
Gene symbol PNOC
Synonyms (NCBI Gene)
N/OFQNOPOFQPPNOCppN/OFQ
Chromosome 8
Chromosome location 8p21.1
Summary This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include nociceptin, nocistatin, and orphanin FQ2 (OFQ2). Nociceptin, also known as orphanin FQ, is a 17-amino acid neuropeptide that
miRNA miRNA information provided by mirtarbase database.
8
miRTarBase ID miRNA Experiments Reference
MIRT029788 hsa-miR-26b-5p Microarray 19088304
MIRT1245313 hsa-miR-31 CLIP-seq
MIRT1245314 hsa-miR-3154 CLIP-seq
MIRT1245315 hsa-miR-3179 CLIP-seq
MIRT1245316 hsa-miR-3656 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
SP1 Unknown 12062800
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0001515 Function Opioid peptide activity IEA
GO:0005184 Function Neuropeptide hormone activity TAS 10419552
GO:0005515 Function Protein binding IPI
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS 9521323
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601459 9163 ENSG00000168081
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13519
Protein name Prepronociceptin [Cleaved into: Nocistatin; Nociceptin (Orphanin FQ) (PPNOC); Orphanin FQ2]
Protein function [Nociceptin]: Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development. {ECO:0000250|UniProtKB:P5579
PDB 8F7X
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01160 Opiods_neuropep 20 66 Vertebrate endogenous opioids neuropeptide Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in the brain and spinal cord. Also expressed and secreted by peripheral blood neutrophils following degranulation. {ECO:0000269|PubMed:12950177}.
Sequence
MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTP
CTKVMA
RSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGE
MEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
Sequence length 176
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Neuroactive ligand-receptor interaction
Hormone signaling
  Peptide ligand-binding receptors
G alpha (i) signalling events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
12
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DEPRESSIVE DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPERALGESIA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPOTENSION CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult Learning Disorders Learning Disorders CTD_human_DG 10401555
★☆☆☆☆
Found in Text Mining only
Age-Related Memory Disorders Age-Related Memory Disorders CTD_human_DG 10401555
★☆☆☆☆
Found in Text Mining only
Amnesia Amnesia BEFREE 31047997
★☆☆☆☆
Found in Text Mining only
Anxiety Anxiety disorder Pubtator 28969474 Associate
★☆☆☆☆
Found in Text Mining only
Arthritis Infectious Infective arthritis Pubtator 21324928 Associate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 26756419, 27562660
★☆☆☆☆
Found in Text Mining only
Autosomal Dominant Juvenile Parkinson Disease Parkinson Disease CTD_human_DG 26687234
★☆☆☆☆
Found in Text Mining only
Autosomal Dominant Parkinsonism Parkinsonian disease CTD_human_DG 26687234
★☆☆☆☆
Found in Text Mining only
Autosomal Recessive Parkinsonism Parkinsonian disease CTD_human_DG 26687234
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 35665772 Associate
★☆☆☆☆
Found in Text Mining only