PNOC (prepronociceptin)

Gene

• Entrez ID: 5368
• Gene name: Prepronociceptin
• Gene symbol: PNOC
• Synonyms (NCBI Gene): N/OFQ, NOP, OFQ, PPNOC, ppN/OFQ
• Chromosome: 8
• Chromosome location: 8p21.1
• Summary: This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include nociceptin, nocistatin, and orphanin FQ2 (OFQ2). Nociceptin, also known as orphanin FQ, is a 17-amino acid neuropeptide that

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029788	hsa-miR-26b-5p	Microarray	19088304
MIRT1245313	hsa-miR-31	CLIP-seq
MIRT1245314	hsa-miR-3154	CLIP-seq
MIRT1245315	hsa-miR-3179	CLIP-seq
MIRT1245316	hsa-miR-3656	CLIP-seq
MIRT1245317	hsa-miR-4468	CLIP-seq
MIRT1245318	hsa-miR-4688	CLIP-seq
MIRT1245319	hsa-miR-4792	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	12062800

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001515	Function	Opioid peptide activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	TAS	10419552
GO:0005515	Function	Protein binding	IPI
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	9521323
GO:0005886	Component	Plasma membrane	IBA
GO:0007165	Process	Signal transduction	TAS	9521323
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007270	Process	Neuron-neuron synaptic transmission	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007600	Process	Sensory perception	IBA
GO:0007600	Process	Sensory perception	TAS	9521323
GO:0019233	Process	Sensory perception of pain	IEA
GO:0030425	Component	Dendrite	IBA
GO:0031628	Function	Opioid receptor binding	IBA
GO:0043025	Component	Neuronal cell body	IBA
GO:0043679	Component	Axon terminus	IBA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0097060	Component	Synaptic membrane	IEA

Other IDs

• MIM: 601459
• HGNC: 9163
• e!Ensembl: ENSG00000168081

Protein

• UniProt ID: Q13519
• Protein name: Prepronociceptin [Cleaved into: Nocistatin; Nociceptin (Orphanin FQ) (PPNOC); Orphanin FQ2]
• Protein function: [Nociceptin]: Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development. {ECO:0000250|UniProtKB:P5579
• PDB: 8F7X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01160	Opiods_neuropep	20 → 66	Vertebrate endogenous opioids neuropeptide	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in the brain and spinal cord. Also expressed and secreted by peripheral blood neutrophils following degranulation. {ECO:0000269|PubMed:12950177}.
• Sequence:

  MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTP
  CTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGE
  MEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV

• Sequence length: 176

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Learning Disorders	Learning Disorders	CTD_human_DG	10401555		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	10401555		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	31047997		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	28969474	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	21324928	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26756419, 27562660		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Juvenile Parkinson Disease	Parkinson Disease	CTD_human_DG	26687234		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Parkinsonism	Parkinsonian disease	CTD_human_DG	26687234		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Parkinsonism	Parkinsonian disease	CTD_human_DG	26687234		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35665772	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33841428	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	21324928	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29107702		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	29931693		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	17879375, 18077069, 19527777		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	31680765		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30112574		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	29232769		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	37408230	Associate	★☆☆☆☆ Found in Text Mining only
Familial Juvenile Parkinsonism	Parkinsonian disease	CTD_human_DG	26687234		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	22706982		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	29578181	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28583844		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28583844		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	12128158		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	LHGDN	12812047		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29107702		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	CTD_human_DG	10401555		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	10401555		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	10401555		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	31680765		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21324928, 31024840		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	10401555		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	17879375, 18077069, 19527777		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	31680765		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	BEFREE	30457160		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	30142397		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	19720395		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	28280884		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	11568656, 12106667, 18286384, 23715695, 26235542, 29316911		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	28347772		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31024840		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30755252		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33568662	Associate	★☆☆☆☆ Found in Text Mining only
Pachyonychia Congenita	Pachyonychia Congenita	BEFREE	30255608		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20589874, 26687234, 29232769		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	CTD_human_DG	26687234		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	20589874		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	CTD_human_DG	26687234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonism, Juvenile	Parkinsonian disease	CTD_human_DG	26687234		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34101221	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30670988, 30954231		★☆☆☆☆ Found in Text Mining only
Ramsay Hunt Paralysis Syndrome	Ramsay Hunt Paralysis Syndrome	CTD_human_DG	26687234		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11436130, 11501941		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	24124588		★☆☆☆☆ Found in Text Mining only
SMALL PATELLA SYNDROME	SMALL PATELLA SYNDROME	BEFREE	30670988		★☆☆☆☆ Found in Text Mining only
Stiff-Person Syndrome	Stiff-Person Syndrome	BEFREE	30670988		★☆☆☆☆ Found in Text Mining only
Stress Disorders, Traumatic	Stress Disorder	BEFREE	28704271		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	32597152	Associate	★☆☆☆☆ Found in Text Mining only