Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5365
Gene name	Plexin B3
Gene symbol	PLXNB3
Synonyms (NCBI Gene)	PLEXB3PLEXRPLXN6
Chromosome	X
Chromosome location	Xq28
Summary	The protein encoded by this gene is a member of the plexin family. It functions as a receptor for semaphorin 5A, and plays a role in axon guidance, invasive growth and cell migration. Alternatively spliced transcript variants encoding different isoforms h

Show/Hide all (43)

miRTarBase ID	miRNA	Experiments
MIRT1243891	hsa-miR-125a-3p	CLIP-seq
MIRT1243892	hsa-miR-1293	CLIP-seq
MIRT1243893	hsa-miR-1587	CLIP-seq
MIRT1243894	hsa-miR-3120-5p	CLIP-seq
MIRT1243895	hsa-miR-3934	CLIP-seq
MIRT1243896	hsa-miR-4271	CLIP-seq
MIRT1243897	hsa-miR-4303	CLIP-seq
MIRT1243898	hsa-miR-4417	CLIP-seq
MIRT1243899	hsa-miR-4447	CLIP-seq
MIRT1243900	hsa-miR-4472	CLIP-seq
MIRT1243901	hsa-miR-4483	CLIP-seq
MIRT1243902	hsa-miR-4492	CLIP-seq
MIRT1243903	hsa-miR-4498	CLIP-seq
MIRT1243904	hsa-miR-4656	CLIP-seq
MIRT1243905	hsa-miR-4675	CLIP-seq
MIRT1243906	hsa-miR-4725-3p	CLIP-seq
MIRT1243907	hsa-miR-4741	CLIP-seq
MIRT1243908	hsa-miR-4747-5p	CLIP-seq
MIRT1243909	hsa-miR-541	CLIP-seq
MIRT1243910	hsa-miR-625	CLIP-seq
MIRT1243911	hsa-miR-626	CLIP-seq
MIRT1243912	hsa-miR-654-5p	CLIP-seq
MIRT1243913	hsa-miR-762	CLIP-seq
MIRT1243914	hsa-miR-764	CLIP-seq
MIRT2072074	hsa-miR-1207-5p	CLIP-seq
MIRT1243893	hsa-miR-1587	CLIP-seq
MIRT2072075	hsa-miR-1909	CLIP-seq
MIRT2072076	hsa-miR-3689d	CLIP-seq
MIRT1243898	hsa-miR-4417	CLIP-seq
MIRT1243902	hsa-miR-4492	CLIP-seq
MIRT1243903	hsa-miR-4498	CLIP-seq
MIRT2072077	hsa-miR-4514	CLIP-seq
MIRT1243904	hsa-miR-4656	CLIP-seq
MIRT1243905	hsa-miR-4675	CLIP-seq
MIRT2072078	hsa-miR-4692	CLIP-seq
MIRT2072079	hsa-miR-4736	CLIP-seq
MIRT1243907	hsa-miR-4741	CLIP-seq
MIRT2072080	hsa-miR-4763-3p	CLIP-seq
MIRT1243911	hsa-miR-626	CLIP-seq
MIRT1243913	hsa-miR-762	CLIP-seq
MIRT1243894	hsa-miR-3120-5p	CLIP-seq
MIRT1243897	hsa-miR-4303	CLIP-seq
MIRT1243911	hsa-miR-626	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	19850054
GO:0002116	Component	Semaphorin receptor complex	IBA
GO:0005515	Function	Protein binding	IPI	15184888, 16122393, 21706053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IDA	16122393
GO:0007162	Process	Negative regulation of cell adhesion	IBA
GO:0007162	Process	Negative regulation of cell adhesion	IDA	15218527
GO:0007162	Process	Negative regulation of cell adhesion	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007416	Process	Synapse assembly	IBA
GO:0008360	Process	Regulation of cell shape	IBA
GO:0009986	Component	Cell surface	IDA	16122393
GO:0010593	Process	Negative regulation of lamellipodium assembly	IEA
GO:0010593	Process	Negative regulation of lamellipodium assembly	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IDA	16122393
GO:0016020	Component	Membrane	IEA
GO:0017154	Function	Semaphorin receptor activity	IBA
GO:0017154	Function	Semaphorin receptor activity	IDA	15218527
GO:0017154	Function	Semaphorin receptor activity	IEA
GO:0019904	Function	Protein domain specific binding	IPI	15218527
GO:0030336	Process	Negative regulation of cell migration	IBA
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	20696765
GO:0034260	Process	Negative regulation of GTPase activity	IMP	20696765
GO:0050772	Process	Positive regulation of axonogenesis	IBA
GO:0050918	Process	Positive chemotaxis	IDA	15218527
GO:0051022	Function	Rho GDP-dissociation inhibitor binding	IEA
GO:0060326	Process	Cell chemotaxis	IDA	15218527
GO:0071526	Process	Semaphorin-plexin signaling pathway	IBA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IDA	15218527
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0098632	Function	Cell-cell adhesion mediator activity	IPI	16122393

MIM	HGNC	e!Ensembl
300214	9105	ENSG00000198753

Q9ULL4

Protein name

Plexin-B3

Protein function

Receptor for SEMA5A that plays a role in axon guidance, invasive growth and cell migration. Stimulates neurite outgrowth and mediates Ca(2+)/Mg(2+)-dependent cell aggregation. In glioma cells, SEMA5A stimulation of PLXNB3 results in the disassem

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01403	Sema	56 → 452	Sema domain	Family
PF01437	PSI	473 → 526	Plexin repeat	Family
PF17960	TIG_plexin	532 → 619	TIG domain	Domain
PF18020	TIG_2	689 → 786	TIG domain found in plexin	Domain
PF01833	TIG	835 → 924	IPT/TIG domain	Domain
PF01833	TIG	927 → 1011	IPT/TIG domain	Domain
PF01833	TIG	1159 → 1243	IPT/TIG domain	Domain
PF08337	Plexin_cytopl	1327 → 1876	Plexin cytoplasmic RasGAP domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expression detected in Purkinje and granular cells in cerebellum, and in brain neocortex but not in corpus callosum. Expressed in glioma cells and embryonic kidney cells (at protein level). Expressed in brain, liver, pancreas and place

Sequence

MCHAAQETPLLHHFMAPVMARWPPFGLCLLLLLLSPPPLPLTGAHRFSAPNTTLNHLALA
PGRGTLYVGAVNRLFQLSPELQLEAVAVTGPVIDSPDCVPFRDPAECPQAQLTDNANQLL
LVSSRAQELVACGQVRQGVCETRRLGDVAEVLYQAEDPGDGQFVAANTPGVATVGLVVPL
PGRDLLLVARGLAGKLSAGVPPLAIRQLAGSQPFSSEGLGRLVVGDFSDYNNSYVGAFAD
ARSAYFVFRRRGARAQAEYRSYVARVCLGDTNLYSYVEVPLACQGQGLIQAAFLAPGTLL
GVFAAGPRGTQAALCAFPMVELGASMEQARRLCYTAGGRGPSGAEEATVEYGVTSRCVTL
PLDSPESYPCGDEHTPSPIAGRQPLEVQPLLKLGQPVSAVAALQADGHMIAFLGDTQGQL
YKVFLHGSQGQVYHSQQVGPPGSAISPDLLLDSSGSHLYVLTAHQVDRIPVAACPQFPDC
ASCLQAQDPLCGWCVLQGRCTRKGQCGRAGQLNQWLWSYEEDSHCLHIQSLLPGHHPRQE
QGQVTLSVPRLPILDADEYFHCAFGDYDSLAHVEGPHVACVTPPQDQVPLNPPGTDHVTV
PLALMFEDVTVAATNFSFYDCSAVQALEAAAPCRACVGSIWRCHWCPQSSHCVYGEHCPE
GERTIYSAQEVDIQVRGPGACPQVEGLAGPHLVPVGWESHLALRVRNLQHFRGLPASFHC
WLELPGELRGLPATLEETAGDSGLIHCQAHQFYPSMSQRELPVPIYVTQGEAQRLDNTHA
LYVILYDCAMGHPDCSHCQAANRSLGCLWCADGQPACRYGPLCPPGAVELLCPAPSIDAV
EPLTGPPEGGLALTILGSNLGRAFADVQYAVSVASRPCNPEPSLYRTSARIVCVTSPAPN
GTTGPVRVAIKSQPPGISSQHFTYQDPVLLSLSPRWGPQAGGTQLTIRGQHLQTGGNTSA
FVGGQPCPILEPVCPEAIVCRTRPQAAPGEAAVLVVFGHAQRTLLASPFRYTANPQLVAA
EPSASFRGGGRLIRVRGTGLDVVQRPLLSVWLEADAEVQASRAQPQDPQPRRSCGAPAAD
PQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRAHPQRVFFTLDNVQVDFASASGGQ
GFLYQPNPRLAPLSREGPARPYRLKPGHVLDVEGEGLNLGISKEEVRVHIGRGECLVKTL
TRTHLYCEPPAHAPQPANGSGLPQFVVQMGNVQLALGPVQYEAEPPLSAFPVEAQAGVGM
GAAVLIAAVLLLTLMYRHKSKQALRDYQKVLVQLESLETGVGDQCRKEFTDLMTEMTDLS
SDLEGSGIPFLDYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVRQGLTQLSNLLNSK
LFLLTLIHTLEEQPSFSQRDRCHVASLLSLALHGKLEYLTDIMRTLLGDLAAHYVHRNPK
LMLRRTETMVEKLLTNWLSICLYAFLREVAGEPLYMLFRAIQYQVDKGPVDAVTGKAKRT
LNDSRLLREDVEFQPLTLMVLVGPGAGGAAGSSEMQRVPARVLDTDTITQVKEKVLDQVY
KGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGL
VPQLHRGSTISQSLAQRCPLGENIPTLEDGEEGGVCLWHLVKATEEPEGAKVRCSSLRER
EPARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPIPIAVKYLFDLLDELAEKHG
IEDPGTLHIWKTNSLLLRFWVNALKNPQLIFDVRVSDNVDAILAVIAQTFIDSCTTSEHK
VGRDSPVNKLLYAREIPRYKQMVERYYADIRQSSPASYQEMNSALAELSGNYTSAPHCLE
ALQELYNHIHRYYDQIISALEEDPVGQKLQLACRLQQVAALVENKVTDL

Sequence length

1909

Interactions

View interactions

	KEGG		Reactome
	Axon guidance		Other semaphorin interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLXNB3-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLXNB3-related Intellectual disability	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	37768037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37919459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20696765, 21706053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19522033	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19462467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17033634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19522033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19522033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PLXNB3 (plexin B3)