PLXNB1 (plexin B1)

Gene

• Entrez ID: 5364
• Gene name: Plexin B1
• Gene symbol: PLXNB1
• Synonyms (NCBI Gene): PLEXIN-B1, PLXN5, SEP
• Chromosome: 3
• Chromosome location: 3p21.31

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005765	hsa-miR-214-3p	GFP reporter assay, Immunohistochemistry, qRT-PCR, Western blot	21216304
MIRT005765	hsa-miR-214-3p	GFP reporter assay, Immunohistochemistry, qRT-PCR, Western blot	21216304
MIRT005765	hsa-miR-214-3p	Microarray;Other	19859982
MIRT1243801	hsa-miR-1193	CLIP-seq
MIRT1243802	hsa-miR-1265	CLIP-seq
MIRT1243803	hsa-miR-142-3p	CLIP-seq
MIRT1243804	hsa-miR-2392	CLIP-seq
MIRT1243805	hsa-miR-3135	CLIP-seq
MIRT1243806	hsa-miR-3183	CLIP-seq
MIRT1243807	hsa-miR-3667-3p	CLIP-seq
MIRT1243808	hsa-miR-3675-5p	CLIP-seq
MIRT1243809	hsa-miR-3677-5p	CLIP-seq
MIRT1243810	hsa-miR-3684	CLIP-seq
MIRT1243811	hsa-miR-4270	CLIP-seq
MIRT1243812	hsa-miR-4279	CLIP-seq
MIRT1243813	hsa-miR-4283	CLIP-seq
MIRT1243814	hsa-miR-4441	CLIP-seq
MIRT1243815	hsa-miR-4489	CLIP-seq
MIRT1243816	hsa-miR-4723-3p	CLIP-seq
MIRT1243802	hsa-miR-1265	CLIP-seq
MIRT1243817	hsa-miR-15a	CLIP-seq
MIRT1243818	hsa-miR-15b	CLIP-seq
MIRT1243819	hsa-miR-16	CLIP-seq
MIRT1243820	hsa-miR-195	CLIP-seq
MIRT1243804	hsa-miR-2392	CLIP-seq
MIRT1243821	hsa-miR-3688-5p	CLIP-seq
MIRT1243822	hsa-miR-3922-5p	CLIP-seq
MIRT1243823	hsa-miR-424	CLIP-seq
MIRT1243811	hsa-miR-4270	CLIP-seq
MIRT1243814	hsa-miR-4441	CLIP-seq
MIRT1243824	hsa-miR-4660	CLIP-seq
MIRT1243825	hsa-miR-4753-5p	CLIP-seq
MIRT1243826	hsa-miR-4764-5p	CLIP-seq
MIRT1243827	hsa-miR-497	CLIP-seq
MIRT1243828	hsa-miR-885-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002116	Component	Semaphorin receptor complex	IBA
GO:0002116	Component	Semaphorin receptor complex	IDA	19843518
GO:0002116	Component	Semaphorin receptor complex	IEA
GO:0002116	Component	Semaphorin receptor complex	ISS
GO:0002116	Component	Semaphorin receptor complex	TAS	19909241
GO:0004888	Function	Transmembrane signaling receptor activity	NAS	10520995
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	12730235, 14732713, 15184888, 15218527, 19843518, 20877282, 22404908, 25531777, 29040270
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	19843518
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	10520995
GO:0005886	Component	Plasma membrane	TAS
GO:0007162	Process	Negative regulation of cell adhesion	IBA
GO:0007162	Process	Negative regulation of cell adhesion	IDA	15218527
GO:0007162	Process	Negative regulation of cell adhesion	IEA
GO:0007416	Process	Synapse assembly	IBA
GO:0008360	Process	Regulation of cell shape	IBA
GO:0008360	Process	Regulation of cell shape	IDA	19843518
GO:0008360	Process	Regulation of cell shape	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	NAS	10520995
GO:0017154	Function	Semaphorin receptor activity	IBA
GO:0017154	Function	Semaphorin receptor activity	IDA	19843518
GO:0017154	Function	Semaphorin receptor activity	IEA
GO:0017154	Function	Semaphorin receptor activity	ISS
GO:0017154	Function	Semaphorin receptor activity	TAS	10520995
GO:0030215	Function	Semaphorin receptor binding	TAS	10520995
GO:0030334	Process	Regulation of cell migration	IBA
GO:0032794	Function	GTPase activating protein binding	IEA
GO:0032794	Function	GTPase activating protein binding	ISS
GO:0033689	Process	Negative regulation of osteoblast proliferation	IEA
GO:0033689	Process	Negative regulation of osteoblast proliferation	ISS
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IEA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	ISS
GO:0035556	Process	Intracellular signal transduction	NAS	10520995
GO:0043547	Process	Positive regulation of GTPase activity	ISS
GO:0043931	Process	Ossification involved in bone maturation	IEA
GO:0043931	Process	Ossification involved in bone maturation	ISS
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048812	Process	Neuron projection morphogenesis	ISS
GO:0050772	Process	Positive regulation of axonogenesis	IBA
GO:0050772	Process	Positive regulation of axonogenesis	IEA
GO:0051493	Process	Regulation of cytoskeleton organization	IDA	19843518
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0071526	Process	Semaphorin-plexin signaling pathway	IBA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IDA	15218527, 19843518
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1904862	Process	Inhibitory synapse assembly	IEA
GO:1904862	Process	Inhibitory synapse assembly	ISS

Other IDs

• MIM: 601053
• HGNC: 9103
• e!Ensembl: ENSG00000164050

Protein

• UniProt ID: O43157
• Protein name: Plexin-B1 (Semaphorin receptor SEP)
• Protein function: Receptor for SEMA4D (PubMed:19843518, PubMed:20877282, PubMed:21912513). Plays a role in GABAergic synapse development (By similarity). Mediates SEMA4A- and SEMA4D-dependent inhibitory synapse development (By similarity). Plays a role in RHOA ac
• PDB: 2JPH, 2OS6, 2R2O, 2REX, 3HM6, 3OL2, 3SU8, 3SUA, 5B4W, 7VF3, 7VG7, 8B3K
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01403	Sema	37 → 460	Sema domain	Family
  PF01437	PSI	481 → 534	Plexin repeat	Family
  PF17960	TIG_plexin	540 → 627	TIG domain	Domain
  PF18020	TIG_2	921 → 1020	TIG domain found in plexin	Domain
  PF01833	TIG	1070 → 1159	IPT/TIG domain	Domain
  PF01833	TIG	1162 → 1248	IPT/TIG domain	Domain
  PF01833	TIG	1252 → 1374	IPT/TIG domain	Domain
  PF08337	Plexin_cytopl	1562 → 2102	Plexin cytoplasmic RasGAP domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in fetal kidney, and at slightly lower levels in fetal brain, lung and liver. {ECO:0000269|PubMed:8570614}.
• Sequence:

  MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSP
  GLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCE
  QRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
  IPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQ
  SRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSA
  APPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDV
  NSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAF
  LGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVA
  SCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
  PANISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLP
  RGADYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLC
  THKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
  ASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRP
  SATPEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKPALD
  WLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDTPGL
  WELEEATLGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLE
  VVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLY
  DCSVGHGDCSRCQTAMPQYGCVWCEGERPRCVTREACGEAEAVATQCPAPLIHSVEPLTG
  PVDGGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLVCITGASGEEVAGA
  TAVEVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVG
  DQPCHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPT
  KSFLSGGREICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSS
  QQFEEPCHVNSSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTL
  QPLNPEDPTMPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPP
  VEQPLPRHHALREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLL
  ALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLG
  SGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFI
  HTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTE
  TVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLL
  REDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDP
  RTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRE
  NQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLT
  RLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNS
  LPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYAR
  DIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYYD
  QIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL

• Sequence length: 2135

Pathways

KEGG:

Axon guidance

Reactome:

G alpha (12/13) signalling events
Sema4D mediated inhibition of cell attachment and migration
Sema4D induced cell migration and growth-cone collapse

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLXNB1-related disorder	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	18279812		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29908079	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	31035427	Associate	★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	9077508		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	29748532		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17317819, 19054665, 22378040, 26035216, 28657175, 28739743, 30762724		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18275816	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18279812		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17511039	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21812859	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21059203		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	30904770		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30904770		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21216304		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21216304		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12406905		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	29908079	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	39596507	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27456345	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	33381571	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15781004		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30590038		★☆☆☆☆ Found in Text Mining only
Epilepsia Partialis Continua	Epilepsia Partialis Continua	BEFREE	30769270		★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	30647802		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24114199	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19940359	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29908079		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	34670012	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	10937150		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31564916		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38186215	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	27956228		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37901456	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	21059203		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21059203, 21812859, 27456345	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37406814	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17317819, 19054665, 22378040, 26035216, 28657175, 28739743, 30762724		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29981162		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	29981162		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27956228, 28732877		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21059203		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18024597, 28004109, 29348142		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12406905, 24114199, 28739743, 30762724		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21216304		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18417270		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20164843	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22189792		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22189792	Inhibit	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30590038		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	33381571	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29748532		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	9077508		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17317819, 19054665, 19762474, 26035216, 28038319, 28739743, 29317734, 29939944		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	CTD_human_DG	28191889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	34854398	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21059203		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21059203, 28893231	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21812859	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18024597, 28004109, 29348142		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18024597, 31861264, 37563360	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	30647802		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18279812		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18279812		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31371483		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30647802		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30981760		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30280591		★☆☆☆☆ Found in Text Mining only