Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	53637
Gene name	Sphingosine-1-phosphate receptor 5
Gene symbol	S1PR5
Synonyms (NCBI Gene)	EDG8Edg-8S1P5SPPR-1SPPR-2
Chromosome	19
Chromosome location	19p13.2
Summary	The lysosphingolipid sphingosine 1-phosphate (S1P) regulates cell proliferation, apoptosis, motility, and neurite retraction. Its actions may be both intracellular as a second messenger and extracellular as a receptor ligand. S1P and the structurally rela

Show/Hide all (76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023008	hsa-miR-124-3p	Microarray	18668037
MIRT1324555	hsa-miR-1321	CLIP-seq
MIRT1324556	hsa-miR-133a	CLIP-seq
MIRT1324557	hsa-miR-133b	CLIP-seq
MIRT1324558	hsa-miR-1915	CLIP-seq
MIRT1324559	hsa-miR-2114	CLIP-seq
MIRT1324560	hsa-miR-3162-5p	CLIP-seq
MIRT1324561	hsa-miR-3929	CLIP-seq
MIRT1324562	hsa-miR-4419b	CLIP-seq
MIRT1324563	hsa-miR-4433	CLIP-seq
MIRT1324564	hsa-miR-4436a	CLIP-seq
MIRT1324565	hsa-miR-4478	CLIP-seq
MIRT1324566	hsa-miR-4645-5p	CLIP-seq
MIRT1324567	hsa-miR-4673	CLIP-seq
MIRT1324568	hsa-miR-4726-3p	CLIP-seq
MIRT1324569	hsa-miR-4739	CLIP-seq
MIRT1324570	hsa-miR-4756-5p	CLIP-seq
MIRT1324571	hsa-miR-485-5p	CLIP-seq
MIRT1324572	hsa-miR-610	CLIP-seq
MIRT1324573	hsa-miR-665	CLIP-seq
MIRT1553213	hsa-miR-1226	CLIP-seq
MIRT1553214	hsa-miR-338-3p	CLIP-seq
MIRT1553215	hsa-miR-4269	CLIP-seq
MIRT1324566	hsa-miR-4645-5p	CLIP-seq
MIRT1324567	hsa-miR-4673	CLIP-seq
MIRT1553216	hsa-miR-634	CLIP-seq
MIRT2096370	hsa-miR-150	CLIP-seq
MIRT1324558	hsa-miR-1915	CLIP-seq
MIRT2096371	hsa-miR-3159	CLIP-seq
MIRT2096372	hsa-miR-331-3p	CLIP-seq
MIRT2096373	hsa-miR-3679-3p	CLIP-seq
MIRT2096374	hsa-miR-4257	CLIP-seq
MIRT1324563	hsa-miR-4433	CLIP-seq
MIRT1324566	hsa-miR-4645-5p	CLIP-seq
MIRT1324567	hsa-miR-4673	CLIP-seq
MIRT2096375	hsa-miR-4713-5p	CLIP-seq
MIRT1324568	hsa-miR-4726-3p	CLIP-seq
MIRT2096376	hsa-miR-532-3p	CLIP-seq
MIRT2096377	hsa-miR-548a-3p	CLIP-seq
MIRT2096378	hsa-miR-548e	CLIP-seq
MIRT2096379	hsa-miR-548f	CLIP-seq
MIRT1324572	hsa-miR-610	CLIP-seq
MIRT2096380	hsa-miR-627	CLIP-seq
MIRT2096381	hsa-miR-647	CLIP-seq
MIRT1324573	hsa-miR-665	CLIP-seq
MIRT2096382	hsa-miR-924	CLIP-seq
MIRT2320556	hsa-miR-125a-5p	CLIP-seq
MIRT2320557	hsa-miR-125b	CLIP-seq
MIRT2320558	hsa-miR-148a	CLIP-seq
MIRT2320559	hsa-miR-148b	CLIP-seq
MIRT2320560	hsa-miR-152	CLIP-seq
MIRT1324558	hsa-miR-1915	CLIP-seq
MIRT1324559	hsa-miR-2114	CLIP-seq
MIRT2320561	hsa-miR-2467-3p	CLIP-seq
MIRT2320562	hsa-miR-3158-5p	CLIP-seq
MIRT2096371	hsa-miR-3159	CLIP-seq
MIRT2320563	hsa-miR-3678-3p	CLIP-seq
MIRT2320564	hsa-miR-3944-5p	CLIP-seq
MIRT2320565	hsa-miR-4289	CLIP-seq
MIRT2320566	hsa-miR-4319	CLIP-seq
MIRT1324563	hsa-miR-4433	CLIP-seq
MIRT1324566	hsa-miR-4645-5p	CLIP-seq
MIRT1324567	hsa-miR-4673	CLIP-seq
MIRT1324568	hsa-miR-4726-3p	CLIP-seq
MIRT2320567	hsa-miR-4732-3p	CLIP-seq
MIRT2096380	hsa-miR-627	CLIP-seq
MIRT2320568	hsa-miR-640	CLIP-seq
MIRT2096381	hsa-miR-647	CLIP-seq
MIRT1324573	hsa-miR-665	CLIP-seq
MIRT2320569	hsa-miR-670	CLIP-seq
MIRT2096382	hsa-miR-924	CLIP-seq
MIRT1324555	hsa-miR-1321	CLIP-seq
MIRT1324559	hsa-miR-2114	CLIP-seq
MIRT1324560	hsa-miR-3162-5p	CLIP-seq
MIRT1324569	hsa-miR-4739	CLIP-seq
MIRT1324570	hsa-miR-4756-5p	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IEA
GO:0098793	Component	Presynapse	IEA

MIM	HGNC	e!Ensembl
605146	14299	ENSG00000180739

Q9H228

Protein name

Sphingosine 1-phosphate receptor 5 (S1P receptor 5) (S1P5) (Endothelial differentiation G-protein-coupled receptor 8) (Sphingosine 1-phosphate receptor Edg-8) (S1P receptor Edg-8)

Protein function

Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Is coupled to both the G(i/0)alpha and G(12) subclass of heteromer

PDB

7EW1 , 7YXA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	53 → 306	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in the brain, most prominently in the corpus callosum, which is predominantly white matter. Detected in spleen, peripheral blood leukocytes, placenta, lung, aorta and fetal spleen. Low-level signal detected in many tis

Sequence

MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD

Sequence length

398

Interactions

View interactions

	KEGG		Reactome
	Sphingolipid signaling pathway Neuroactive ligand-receptor interaction		G alpha (i) signalling events Lysosphingolipid and LPA receptors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, SYSTEMIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21945191, 27868302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32907751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24903384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24903384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24903384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	31465552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29688337		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12427546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18477771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	31603362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24333325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30712233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	38287231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34092610	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32322257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30712233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20950786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34536521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24333325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26485657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29033951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	CTD_human_DG	29033951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	29608575		★★★★★ ★☆☆☆☆ Found in Text Mining only

S1PR5 (sphingosine-1-phosphate receptor 5)