Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5360
Gene name	Phospholipid transfer protein
Gene symbol	PLTP
Synonyms (NCBI Gene)	BPIFEHDLCQ9
Chromosome	20
Chromosome location	20q13.12
Summary	The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017519	hsa-miR-335-5p	Microarray	18185580
MIRT2456715	hsa-miR-1225-5p	CLIP-seq
MIRT2456716	hsa-miR-1321	CLIP-seq
MIRT2456717	hsa-miR-184	CLIP-seq
MIRT2456718	hsa-miR-1915	CLIP-seq
MIRT2456719	hsa-miR-3165	CLIP-seq
MIRT2456720	hsa-miR-3664-3p	CLIP-seq
MIRT2456721	hsa-miR-3670	CLIP-seq
MIRT2456722	hsa-miR-3688-3p	CLIP-seq
MIRT2456723	hsa-miR-3689d	CLIP-seq
MIRT2456724	hsa-miR-3914	CLIP-seq
MIRT2456725	hsa-miR-4270	CLIP-seq
MIRT2456726	hsa-miR-4436a	CLIP-seq
MIRT2456727	hsa-miR-4441	CLIP-seq
MIRT2456728	hsa-miR-4690-3p	CLIP-seq
MIRT2456729	hsa-miR-4726-3p	CLIP-seq
MIRT2456730	hsa-miR-4739	CLIP-seq
MIRT2456731	hsa-miR-4756-5p	CLIP-seq
MIRT2456732	hsa-miR-4804-5p	CLIP-seq
MIRT2456733	hsa-miR-873	CLIP-seq
MIRT2456715	hsa-miR-1225-5p	CLIP-seq
MIRT2456716	hsa-miR-1321	CLIP-seq
MIRT2456717	hsa-miR-184	CLIP-seq
MIRT2456718	hsa-miR-1915	CLIP-seq
MIRT2456719	hsa-miR-3165	CLIP-seq
MIRT2456720	hsa-miR-3664-3p	CLIP-seq
MIRT2456721	hsa-miR-3670	CLIP-seq
MIRT2456722	hsa-miR-3688-3p	CLIP-seq
MIRT2456723	hsa-miR-3689d	CLIP-seq
MIRT2456724	hsa-miR-3914	CLIP-seq
MIRT2456725	hsa-miR-4270	CLIP-seq
MIRT2456726	hsa-miR-4436a	CLIP-seq
MIRT2456727	hsa-miR-4441	CLIP-seq
MIRT2456728	hsa-miR-4690-3p	CLIP-seq
MIRT2456729	hsa-miR-4726-3p	CLIP-seq
MIRT2456730	hsa-miR-4739	CLIP-seq
MIRT2456731	hsa-miR-4756-5p	CLIP-seq
MIRT2456732	hsa-miR-4804-5p	CLIP-seq
MIRT2456733	hsa-miR-873	CLIP-seq
MIRT2456715	hsa-miR-1225-5p	CLIP-seq
MIRT2456716	hsa-miR-1321	CLIP-seq
MIRT2456717	hsa-miR-184	CLIP-seq
MIRT2456718	hsa-miR-1915	CLIP-seq
MIRT2456719	hsa-miR-3165	CLIP-seq
MIRT2456720	hsa-miR-3664-3p	CLIP-seq
MIRT2456721	hsa-miR-3670	CLIP-seq
MIRT2595925	hsa-miR-3671	CLIP-seq
MIRT2456722	hsa-miR-3688-3p	CLIP-seq
MIRT2456723	hsa-miR-3689d	CLIP-seq
MIRT2456724	hsa-miR-3914	CLIP-seq
MIRT2456725	hsa-miR-4270	CLIP-seq
MIRT2456726	hsa-miR-4436a	CLIP-seq
MIRT2595926	hsa-miR-4438	CLIP-seq
MIRT2456727	hsa-miR-4441	CLIP-seq
MIRT2456728	hsa-miR-4690-3p	CLIP-seq
MIRT2456729	hsa-miR-4726-3p	CLIP-seq
MIRT2456730	hsa-miR-4739	CLIP-seq
MIRT2456731	hsa-miR-4756-5p	CLIP-seq
MIRT2595927	hsa-miR-4762-5p	CLIP-seq
MIRT2456732	hsa-miR-4804-5p	CLIP-seq
MIRT2595928	hsa-miR-5095	CLIP-seq
MIRT2595929	hsa-miR-605	CLIP-seq
MIRT2595930	hsa-miR-607	CLIP-seq
MIRT2595931	hsa-miR-637	CLIP-seq
MIRT2456733	hsa-miR-873	CLIP-seq
MIRT2595932	hsa-miR-877	CLIP-seq
MIRT2456715	hsa-miR-1225-5p	CLIP-seq
MIRT2688220	hsa-miR-1247	CLIP-seq
MIRT2456716	hsa-miR-1321	CLIP-seq
MIRT2456717	hsa-miR-184	CLIP-seq
MIRT2456718	hsa-miR-1915	CLIP-seq
MIRT2456719	hsa-miR-3165	CLIP-seq
MIRT2456720	hsa-miR-3664-3p	CLIP-seq
MIRT2456721	hsa-miR-3670	CLIP-seq
MIRT2595925	hsa-miR-3671	CLIP-seq
MIRT2456722	hsa-miR-3688-3p	CLIP-seq
MIRT2456723	hsa-miR-3689d	CLIP-seq
MIRT2456724	hsa-miR-3914	CLIP-seq
MIRT2456725	hsa-miR-4270	CLIP-seq
MIRT2456726	hsa-miR-4436a	CLIP-seq
MIRT2595926	hsa-miR-4438	CLIP-seq
MIRT2456727	hsa-miR-4441	CLIP-seq
MIRT2456728	hsa-miR-4690-3p	CLIP-seq
MIRT2456729	hsa-miR-4726-3p	CLIP-seq
MIRT2456730	hsa-miR-4739	CLIP-seq
MIRT2456731	hsa-miR-4756-5p	CLIP-seq
MIRT2595927	hsa-miR-4762-5p	CLIP-seq
MIRT2456732	hsa-miR-4804-5p	CLIP-seq
MIRT2595928	hsa-miR-5095	CLIP-seq
MIRT2595929	hsa-miR-605	CLIP-seq
MIRT2595930	hsa-miR-607	CLIP-seq
MIRT2595931	hsa-miR-637	CLIP-seq
MIRT2456733	hsa-miR-873	CLIP-seq
MIRT2595932	hsa-miR-877	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NR1H4	Unknown	10998425

Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005576	Component	Extracellular region	IDA	19321130
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	7654777
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IDA	19321130
GO:0005634	Component	Nucleus	IEA
GO:0006629	Process	Lipid metabolic process	TAS	7654777
GO:0006869	Process	Lipid transport	IDA	9132017
GO:0006869	Process	Lipid transport	IEA
GO:0008035	Function	High-density lipoprotein particle binding	IDA	29883800
GO:0008289	Function	Lipid binding	IEA
GO:0008429	Function	Phosphatidylethanolamine binding	IDA	9132017
GO:0008526	Function	Phosphatidylinositol transfer activity	IEA
GO:0008526	Function	Phosphatidylinositol transfer activity	ISS
GO:0010189	Process	Vitamin E biosynthetic process	IEA
GO:0010875	Process	Positive regulation of cholesterol efflux	IDA	24369175
GO:0015914	Process	Phospholipid transport	IBA
GO:0015914	Process	Phospholipid transport	IDA	9132017
GO:0015918	Process	Sterol transport	IEA
GO:0019992	Function	Diacylglycerol binding	IDA	9132017
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	29883800
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0031210	Function	Phosphatidylcholine binding	IDA	9132017
GO:0034189	Function	Very-low-density lipoprotein particle binding	IDA	29883800
GO:0034364	Component	High-density lipoprotein particle	IDA	9132017
GO:0034375	Process	High-density lipoprotein particle remodeling	IBA
GO:0034375	Process	High-density lipoprotein particle remodeling	IDA	9132017, 24369175, 29883800
GO:0035627	Process	Ceramide transport	IBA
GO:0035627	Process	Ceramide transport	IDA	9132017
GO:0046836	Process	Glycolipid transport	IDA	9132017
GO:0070300	Function	Phosphatidic acid binding	IDA	9132017
GO:0097001	Function	Ceramide binding	IDA	9132017
GO:0120009	Process	Intermembrane lipid transfer	IEA
GO:0120014	Function	Phospholipid transfer activity	IDA	7654777, 11013307, 19321130, 29883800
GO:0120014	Function	Phospholipid transfer activity	IEA
GO:0120014	Function	Phospholipid transfer activity	IMP	21515415
GO:0120017	Function	Ceramide transfer activity	IBA
GO:0120019	Function	Phosphatidylcholine transfer activity	IDA	9132017
GO:0120019	Function	Phosphatidylcholine transfer activity	IEA
GO:0120020	Function	Cholesterol transfer activity	IEA
GO:0120020	Function	Cholesterol transfer activity	ISS
GO:0140337	Function	Diacylglyceride transfer activity	IDA	9132017
GO:0140338	Function	Sphingomyelin transfer activity	IDA	9132017
GO:0140338	Function	Sphingomyelin transfer activity	IEA
GO:0140339	Function	Phosphatidylglycerol transfer activity	IDA	9132017
GO:0140340	Function	Cerebroside transfer activity	IDA	9132017
GO:1901611	Function	Phosphatidylglycerol binding	IDA	9132017
GO:1904121	Function	Phosphatidylethanolamine transfer activity	IBA
GO:1904121	Function	Phosphatidylethanolamine transfer activity	IDA	9132017
GO:1904121	Function	Phosphatidylethanolamine transfer activity	IEA
GO:1990050	Function	Phosphatidic acid transfer activity	IBA
GO:1990050	Function	Phosphatidic acid transfer activity	IDA	9132017

MIM	HGNC	e!Ensembl
172425	9093	ENSG00000100979

P55058

Protein name

Phospholipid transfer protein (Lipid transfer protein II)

Protein function

Mediates the transfer of phospholipids and free cholesterol from triglyceride-rich lipoproteins (low density lipoproteins or LDL and very low density lipoproteins or VLDL) into high-density lipoproteins (HDL) as well as the exchange of phospholi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01273	LBP_BPI_CETP	30 → 202	LBP / BPI / CETP family, N-terminal domain	Family
PF02886	LBP_BPI_CETP_C	228 → 464	LBP / BPI / CETP family, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highest level of expression in the ovary, thymus and placenta, with moderate levels found in the pancreas, small intestine, testis, lung and prostrate. Low level expression in the kidney, liver and spleen, with very l

Sequence

MALFGALFLALLAGAHAEFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGH
FYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASA
EGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLL
NQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFP
LTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLD
MLLRATYFGSIVLLSPAVIDSPLKLELRVLAPPRCTIKPSGTTISVTASVTIALVPPDQP
EVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAPLKTMLQI
GVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLREVIEKNRPADV
RASTAPTPSTAAV

Sequence length

493

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Cholesterol metabolism		HDL remodeling NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLIPIDEMIAS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALACTOSIALIDOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTRIGLYCERIDEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLTP-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECLASSIFIED - PLTP POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (67)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Age related macular degeneration	Age-related macular degeneration	BEFREE	27605007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30618663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30618663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	27250500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	20382708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	35341274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12086920, 15258196, 15694928, 16935026, 17761633, 18421000, 19100548, 19965587, 21252068, 21736953, 22037227, 28012603, 28596518, 29438986, 29565987, 29680823, 31017809 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29565987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29565987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12086920, 15258196, 15694928, 16935026, 17761633, 18421000, 19100548, 19965587, 21252068, 21736953, 22037227, 28012603, 28596518, 29438986, 29565987, 29680823, 31017809 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	14993244, 18421000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19446293, 19965587, 25710294, 29565987, 32641418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32197906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	27605007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	27879288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38022651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20644014, 21973210, 29883800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21973210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	BEFREE	19965587, 26009633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	19965587, 26009633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteryl Ester Transfer Protein Deficiency	Hyperalphalipoproteinemia	BEFREE	19013296, 19023137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	38502899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12086920, 12835223, 16644710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12086920, 16644710		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	17917406		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	25710294	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	16644710, 21347282, 25710294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12086920, 16644710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	14695459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16644710, 21973210, 26009633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16644710, 21973210, 26009633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21973210	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25710294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	16644710, 21973210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16644710, 21973210, 29947103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	11324722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	CTD_human_DG	17952847		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	BEFREE	29883800		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	16226489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27864281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27864281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	BEFREE	22090281		★★★★★ ★☆☆☆☆ Found in Text Mining only
HYPERALPHALIPOPROTEINEMIA 1	Hyperalphalipoproteinemia	BEFREE	19023137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	11473048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10428983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	BEFREE	16388083, 19013296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	38027143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30337619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	27605007	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	27864281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19676041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	26160914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29947103, 31220615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30367882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37299978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	19446293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27864281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29947103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21973210, 31220615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21973210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	18826383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	18826383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	9624168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29565987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28596518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32735728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	19446293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PLTP (phospholipid transfer protein)