Gene Gene information from NCBI Gene database.
Entrez ID 5348
Gene name FXYD domain containing ion transport regulator 1
Gene symbol FXYD1
Synonyms (NCBI Gene)
PLM
Chromosome 19
Chromosome location 19q13.12
Summary This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature f
miRNA miRNA information provided by mirtarbase database.
57
miRTarBase ID miRNA Experiments Reference
MIRT488775 hsa-miR-6805-5p PAR-CLIP 23592263
MIRT488774 hsa-miR-6786-5p PAR-CLIP 23592263
MIRT488773 hsa-miR-3179 PAR-CLIP 23592263
MIRT488772 hsa-miR-3665 PAR-CLIP 23592263
MIRT488771 hsa-miR-658 PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0005254 Function Chloride channel activity TAS 9169143
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 9169143
GO:0005886 Component Plasma membrane TAS 9169143
GO:0005890 Component Sodium:potassium-exchanging ATPase complex ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602359 4025 ENSG00000266964
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00168
Protein name Phospholemman (FXYD domain-containing ion transport regulator 1) (Sodium/potassium-transporting ATPase subunit FXYD1)
Protein function Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na(+) out of the cell and K(+) into the cell. Inhibits NKA activity in its unphosphorylated state and stimulates activity when phosphor
PDB 2JO1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02038 ATP1G1_PLM_MAT8 24 70 ATP1G1/PLM/MAT8 family Family
Tissue specificity TISSUE SPECIFICITY: Highest expression in skeletal muscle and heart. Moderate levels in brain, placenta, lung, liver, pancreas, uterus, bladder, prostate, small intestine and colon with mucosal lining. Very low levels in kidney, colon and small intestine
Sequence
MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRC
RCKFNQQQRT
GEPDEEEGTFRSSIRRLSTRRR
Sequence length 92
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  cAMP signaling pathway   Ion homeostasis
Ion transport by P-type ATPases
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SCHIZOPHRENIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 22046305 Associate
★☆☆☆☆
Found in Text Mining only
Anus, Imperforate Imperforate anus BEFREE 30386899
★☆☆☆☆
Found in Text Mining only
Aortic Valve Insufficiency Aortic Valve Insufficiency BEFREE 30165515
★☆☆☆☆
Found in Text Mining only
Cardiomyopathies Cardiomyopathy Pubtator 20090424 Stimulate
★☆☆☆☆
Found in Text Mining only
Cerebrovascular accident Stroke BEFREE 29982243
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 21352556
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 21352556 Associate
★☆☆☆☆
Found in Text Mining only
Congestive heart failure Congestive Heart Failure BEFREE 23224879, 30554649
★☆☆☆☆
Found in Text Mining only
Coronary Arteriosclerosis Coronary Arteriosclerosis BEFREE 24039836
★☆☆☆☆
Found in Text Mining only
Degenerative polyarthritis Arthritis BEFREE 30660720
★☆☆☆☆
Found in Text Mining only