PLK1 (polo like kinase 1)

Gene

• Entrez ID: 5347
• Gene name: Polo like kinase 1
• Gene symbol: PLK1
• Synonyms (NCBI Gene): PLK, STPK13
• Chromosome: 16
• Chromosome location: 16p12.2
• Summary: The Ser/Thr protein kinase encoded by this gene belongs to the CDC5/Polo subfamily. It is highly expressed during mitosis and elevated levels are found in many different types of cancer. Depletion of this protein in cancer cells dramatically inhibited cel

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001430	hsa-miR-16-5p	pSILAC	18668040
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR	19739117
MIRT006042	hsa-miR-593-5p	Luciferase reporter assay, qRT-PCR, Western blot	21170987
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	22120675
MIRT006042	hsa-miR-593-5p	Luciferase reporter assay, qRT-PCR, Western blot	21170987
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	22120675
MIRT006042	hsa-miR-593-5p	Luciferase reporter assay, qRT-PCR, Western blot	21170987
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	22120675
MIRT000382	hsa-miR-100-5p	Immunoblot, Immunohistochemistry, qRT-PCR, Western blot	21636267
MIRT020615	hsa-miR-155-5p	Proteomics	18668040
MIRT001430	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT051975	hsa-let-7b-5p	CLASH	23622248
MIRT038920	hsa-miR-92a-1-5p	CLASH	23622248
MIRT037761	hsa-miR-874-3p	CLASH	23622248
MIRT037217	hsa-miR-877-5p	CLASH	23622248
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	23151088
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, Western blot	23842624
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, Western blot	23842624
MIRT053537	hsa-miR-10b-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23125021
MIRT000382	hsa-miR-100-5p	Western blot	22249248
MIRT194901	hsa-miR-3120-3p	PAR-CLIP	23446348
MIRT504618	hsa-miR-1322	PAR-CLIP	23446348
MIRT194895	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT194900	hsa-miR-2276-3p	PAR-CLIP	23446348
MIRT504617	hsa-miR-4708-3p	PAR-CLIP	23446348
MIRT504616	hsa-miR-4660	PAR-CLIP	23446348
MIRT504615	hsa-miR-1301-3p	PAR-CLIP	23446348
MIRT504614	hsa-miR-5047	PAR-CLIP	23446348
MIRT732109	hsa-miR-296-5p	Luciferase reporter assay, Western blot	26549165
MIRT732109	hsa-miR-296-5p	Luciferase reporter assay, Western blot	26549165
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT194895	hsa-miR-1224-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33976745
MIRT194895	hsa-miR-1224-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33976745
MIRT733426	hsa-miR-122-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32700753
MIRT194901	hsa-miR-3120-3p	PAR-CLIP	23446348
MIRT504618	hsa-miR-1322	PAR-CLIP	23446348
MIRT194895	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT194900	hsa-miR-2276-3p	PAR-CLIP	23446348
MIRT504617	hsa-miR-4708-3p	PAR-CLIP	23446348
MIRT504616	hsa-miR-4660	PAR-CLIP	23446348
MIRT504615	hsa-miR-1301-3p	PAR-CLIP	23446348
MIRT504614	hsa-miR-5047	PAR-CLIP	23446348
MIRT1242886	hsa-miR-4778-5p	CLIP-seq
MIRT2071781	hsa-miR-1203	CLIP-seq
MIRT2071782	hsa-miR-1913	CLIP-seq
MIRT2071783	hsa-miR-3194-3p	CLIP-seq
MIRT2071784	hsa-miR-324-3p	CLIP-seq
MIRT2071785	hsa-miR-4492	CLIP-seq
MIRT2071786	hsa-miR-4498	CLIP-seq
MIRT2071787	hsa-miR-4505	CLIP-seq
MIRT2071788	hsa-miR-4508	CLIP-seq
MIRT2071789	hsa-miR-4655-5p	CLIP-seq
MIRT2071790	hsa-miR-4691-3p	CLIP-seq
MIRT2071791	hsa-miR-4731-5p	CLIP-seq
MIRT2071792	hsa-miR-637	CLIP-seq
MIRT2071793	hsa-miR-762	CLIP-seq
MIRT2298932	hsa-miR-183	CLIP-seq
MIRT2298933	hsa-miR-2276	CLIP-seq
MIRT2298934	hsa-miR-3158-5p	CLIP-seq
MIRT2298935	hsa-miR-3166	CLIP-seq
MIRT2298936	hsa-miR-4418	CLIP-seq
MIRT2071785	hsa-miR-4492	CLIP-seq
MIRT2071786	hsa-miR-4498	CLIP-seq
MIRT2071787	hsa-miR-4505	CLIP-seq
MIRT2071788	hsa-miR-4508	CLIP-seq
MIRT2071789	hsa-miR-4655-5p	CLIP-seq
MIRT2071791	hsa-miR-4731-5p	CLIP-seq
MIRT2298937	hsa-miR-4771	CLIP-seq
MIRT1242886	hsa-miR-4778-5p	CLIP-seq
MIRT2298938	hsa-miR-4789-5p	CLIP-seq
MIRT2298939	hsa-miR-509-5p	CLIP-seq
MIRT2298940	hsa-miR-541	CLIP-seq
MIRT2071792	hsa-miR-637	CLIP-seq
MIRT2298941	hsa-miR-654-5p	CLIP-seq
MIRT2071793	hsa-miR-762	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	24076372
E2F3	Unknown	16909110
E2F4	Repression	17981789
TP53	Unknown	24076372

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IMP	23455478
GO:0000070	Process	Mitotic sister chromatid segregation	TAS
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	19160488
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	18174154
GO:0000132	Process	Establishment of mitotic spindle orientation	IDA	23509069
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	IDA	18615013
GO:0000278	Process	Mitotic cell cycle	IMP	18477460
GO:0000278	Process	Mitotic cell cycle	TAS	9177283
GO:0000280	Process	Nuclear division	IEA
GO:0000281	Process	Mitotic cytokinesis	IDA	19468302
GO:0000281	Process	Mitotic cytokinesis	TAS
GO:0000287	Function	Magnesium ion binding	IMP	17461553
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	18417535, 26811421, 29670289, 30612738, 35597237
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	17617734, 18477460, 18615013, 21041660, 23455478, 24157919, 25395579
GO:0000776	Component	Kinetochore	IEA
GO:0000779	Component	Condensed chromosome, centromeric region	IEA
GO:0000785	Component	Chromatin	IEA
GO:0000795	Component	Synaptonemal complex	IEA
GO:0000922	Component	Spindle pole	IBA
GO:0000922	Component	Spindle pole	IDA	18331714, 21041660
GO:0000922	Component	Spindle pole	IEA
GO:0000940	Component	Outer kinetochore	IDA	18195732
GO:0001578	Process	Microtubule bundle formation	IDA	12939256
GO:0004672	Function	Protein kinase activity	IDA	17146433, 19596235, 22854038
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	17461553
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	18378770, 20577264
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	12524548, 12939256, 15148369, 17351640, 18174154, 18477460, 19160488, 19468300, 19468302, 21857149, 22325354, 23509069, 28512243, 37440612, 37674080
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	19473992, 21041660, 23455478
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	12493754, 12524548, 12939256, 15070733, 15148369, 15654075, 16439210, 16753148, 16760428, 16815967, 16864798, 16980960, 17146433, 17307877, 17310276, 17351640, 17495026, 18174154, 18250300, 18329369, 18331714, 18477460, 18521620, 18615013, 18794143, 19160488, 19468300, 19468302, 194
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	IMP	17461553
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18615013
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	8991084, 12524548, 18477460, 18615013, 21041660, 21399614, 23455478, 24157919, 27579920
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IEA
GO:0005819	Component	Spindle	IDA	12939256, 17351640
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005876	Component	Spindle microtubule	IDA	21041660
GO:0006302	Process	Double-strand break repair	IDA	22325354
GO:0006468	Process	Protein phosphorylation	IDA	19468300, 20679239, 22701722, 23509069
GO:0006468	Process	Protein phosphorylation	IMP	17461553
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0007052	Process	Mitotic spindle organization	TAS
GO:0007062	Process	Sister chromatid cohesion	TAS
GO:0007076	Process	Mitotic chromosome condensation	TAS
GO:0007077	Process	Mitotic nuclear membrane disassembly	TAS
GO:0007091	Process	Metaphase/anaphase transition of mitotic cell cycle	TAS
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	IMP	23455478
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IDA	18662541
GO:0007098	Process	Centrosome cycle	IMP	8991084, 18477460
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	17495026
GO:0008017	Function	Microtubule binding	IDA	12939256
GO:0010564	Process	Regulation of cell cycle process	IEA
GO:0010997	Function	Anaphase-promoting complex binding	IPI	18662541
GO:0015630	Component	Microtubule cytoskeleton	IDA	21041660
GO:0016301	Function	Kinase activity	IEA
GO:0016321	Process	Female meiosis chromosome segregation	IEA
GO:0016567	Process	Protein ubiquitination	IDA	16885022
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	16885022
GO:0019901	Function	Protein kinase binding	IPI	12639966, 18615013
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IDA	23509069
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IMP	21041660
GO:0030496	Component	Midbody	IDA	19468300
GO:0030496	Component	Midbody	IEA
GO:0031648	Process	Protein destabilization	IDA	16885022
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	19473992
GO:0032465	Process	Regulation of cytokinesis	IDA	17351640
GO:0032465	Process	Regulation of cytokinesis	IMP	12939256
GO:0033365	Process	Protein localization to organelle	IEA
GO:0034451	Component	Centriolar satellite	IEA
GO:0042802	Function	Identical protein binding	IPI	21041660, 23354166, 26192437
GO:0043066	Process	Negative regulation of apoptotic process	IMP	18174154
GO:0045143	Process	Homologous chromosome segregation	IEA
GO:0045184	Process	Establishment of protein localization	IMP	18331714
GO:0045862	Process	Positive regulation of proteolysis	IDA	16885022
GO:0048313	Process	Golgi inheritance	TAS
GO:0051081	Process	Nuclear membrane disassembly	IMP	20679239
GO:0051233	Component	Spindle midzone	IDA	19468302, 21041660
GO:0051299	Process	Centrosome separation	IDA	18086858
GO:0051301	Process	Cell division	IEA
GO:0051443	Process	Positive regulation of ubiquitin-protein transferase activity	IMP	19473992
GO:0051726	Process	Regulation of cell cycle	TAS
GO:0070194	Process	Synaptonemal complex disassembly	IEA
GO:0071168	Process	Protein localization to chromatin	IDA	21111234
GO:0071539	Process	Protein localization to centrosome	IDA	21076410
GO:0090435	Process	Protein localization to nuclear envelope	IMP	20679239
GO:0097431	Component	Mitotic spindle pole	IEA
GO:0097681	Process	Double-strand break repair via alternative nonhomologous end joining	IDA	37440612, 37674080
GO:0097681	Process	Double-strand break repair via alternative nonhomologous end joining	IDA	37440612, 37674080
GO:0106310	Function	Protein serine kinase activity	IDA	21723128
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	TAS
GO:1901673	Process	Regulation of mitotic spindle assembly	IDA	22621898
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1904668	Process	Positive regulation of ubiquitin protein ligase activity	IDA	15148369
GO:1904776	Process	Regulation of protein localization to cell cortex	IDA	23509069
GO:1905784	Process	Regulation of anaphase-promoting complex-dependent catabolic process	TAS
GO:1990166	Process	Protein localization to site of double-strand break	IDA	37440612, 37674080
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IDA	28512243

Other IDs

• MIM: 602098
• HGNC: 9077
• e!Ensembl: ENSG00000166851

Protein

• UniProt ID: P53350
• Protein name: Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13)
• Protein function: Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesins from chromosome arms, the inactivatio
• PDB: 1Q4K, 1Q4O, 1UMW, 2OGQ, 2OJX, 2OU7, 2OWB, 2RKU, 2V5Q, 2YAC, 3BZI, 3C5L, 3FC2, 3FVH, 3HIH, 3HIK, 3KB7, 3P2W, 3P2Z, 3P34, 3P35, 3P36, 3P37, 3Q1I, 3RQ7, 3THB, 4A4L, 4A4O, 4DFW, 4E67, 4E9C, 4E9D, 4H5X, 4H71, 4HAB, 4HCO, 4HY2, 4J52, 4J53, 4LKL, 4LKM, 4O56, 4O6W, 4O9W, 4RCP, 4WHH, 4WHK, 4WHL, 4X9R, 4X9V, 4X9W
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	53 → 305	Protein kinase domain	Domain
  PF00659	POLO_box	418 → 479	POLO box duplicated region	Family
  PF00659	POLO_box	516 → 583	POLO box duplicated region	Family

• Tissue specificity: TISSUE SPECIFICITY: Placenta and colon.
• Sequence:

  MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLG
  KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFF
  EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG
  NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
  MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
  NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEE
  PVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
  YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLK
  YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTK
  LILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
  KAS

• Sequence length: 603

Pathways

KEGG:

FoxO signaling pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation

Reactome:

Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Polo-like kinase mediated events
Golgi Cisternae Pericentriolar Stack Reorganization
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Phosphorylation of the APC/C
Phosphorylation of Emi1
Condensation of Prophase Chromosomes
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
Regulation of PLK1 Activity at G2/M Transition
Activation of NIMA Kinases NEK9, NEK6, NEK7
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
RHO GTPases Activate Formins
Mitotic Prometaphase
Mitotic Metaphase/Anaphase Transition
Mitotic Telophase/Cytokinesis
Cyclin A/B1/B2 associated events during G2/M transition
The role of GTSE1 in G2/M progression after G2 checkpoint
AURKA Activation by TPX2
EML4 and NUDC in mitotic spindle formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Recurrent spontaneous abortion	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trichothiodystrophy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRICHOTHIODYSTROPHY SYNDROMES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	30104712		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	19421227		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23037713, 30747067		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	16648550		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	23037713, 30747067		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22120675, 28724602, 29187890, 30405824, 30498349, 30760542		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16237758		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29549256		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	29549256		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	30413320, 32373071	Associate	★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30912195, 31259656		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	21652733, 22390279, 24019381, 28270075, 28283778, 30611741, 31541075		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	25398439		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21931181		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	11678424		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	17981789, 23509868, 30243708		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	22593191, 32286328	Associate	★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	39358545	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Rupture	Aortic Rupture	BEFREE	28692064		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	29716963		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	15173270		★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	29228610		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17943598		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29749476, 30260324, 30395539, 31259656		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15176053, 31187492		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15761500, 16837776, 21364537, 26876462, 27878946, 29246203, 30277841		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	35119917	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	35436627	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12082631, 15160994, 16740723, 17369857, 21953073, 22309939, 22405092, 22465097, 22517885, 24626184, 24835992, 25480943, 26171916, 27409838, 28915707, 29288948, 29437878, 29493466, 30069007, 31072423		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21352579, 21707964, 22309939, 22405092, 23506640, 23770244, 24324792, 24626184, 24835992, 24876664, 25505268, 27064522, 27368372, 27409838, 27558135, 28061448, 30097312, 30108112, 32799774, 33313822, 34561554, 34967572, 35454120, 35456460, 36008466, 36749874, 36951624, 37893423, 37976368, 38186570, 39340434, 39596658, 9094972	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial disease	Pubtator	29997230	Stimulate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	16160013		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	16160013, 32468878	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	19739117		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16630118, 19473992, 20089605, 26090465, 29246203, 33840043, 36068491	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12082631, 15176053, 16237758, 16837776, 16865274, 18056432, 23494182		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	19652546	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19725153, 21480320, 26799423, 28648284, 29658607, 29728556, 29843122, 29843214, 30598500, 30705088, 32252611, 32275843, 32627011, 34522226, 34696748, 34743578, 34961841, 35812416, 37986299, 40611075	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15761500, 16837776, 21364537, 26876462, 27878946, 29246203, 30277841		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	21189159		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15173270, 15569479, 22115795, 22248814, 23153503, 23836654, 26036843, 28557434, 30498349		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22246341	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23494182, 37033923	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19652546	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21602893, 30846478, 34080290, 36247089, 37185598, 37442189, 38272206	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22246341, 25592872, 27748936, 29653924		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31042405		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27899378		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12082631, 22262171, 27899378		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	23753023		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21652733, 22390279, 24019381, 28270075, 28283778, 30611741, 31541075		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	21965739		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28648284, 28652654	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30272356	Stimulate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	31832331		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	27557495	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30601084		★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	28614913	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16052696, 16237758, 22753241, 22862168, 28341486, 29549256		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16237758		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16237758	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11597015, 12708489, 19098285, 20473941, 21739483, 21797676, 22648245, 22753241, 23887393, 27629291, 28341486, 29402316, 29774081, 31493507, 31650021		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12708489		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12708489, 16052696, 16237758, 19098285, 20581060, 22648245, 24876664, 26047016, 26577686, 32096168, 32259417, 34735919, 35484177, 36267311	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	24876664		★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	35058575	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25818805, 30272356		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21642374, 23494182, 31186514		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	28626898		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17434144		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	35058575	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28286049		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30474315	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28286049		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28286049, 29710485		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34557161	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	27538997		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19452252, 28416758, 30912195, 31259656		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11410324		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33859719	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18353325		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18353325	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22246341, 25592872, 27748936, 29653924		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	31040125		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	18714168, 21170987, 22108192		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	18714168, 21170987, 22108192		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	19887553, 28881742		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	14735186		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11678424, 12029442, 19887553, 23790466, 23887645, 24204733, 29339188, 30217967		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23047041, 27557495, 35256538, 37644431	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11678424, 12029442, 19887553, 21555372, 22415968, 23404835, 23790466, 23887645, 24204733, 29339188, 30217967		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12029442, 22000864, 28178660, 28820331, 29771424, 30133120, 30924320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	22000864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	28178660, 29771424, 30133120, 30995921, 37872147	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft vs Host Disease	Graft-versus-host disease	Pubtator	39201599	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29789652		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37272763	Associate	★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	30846478		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	19421227, 25697066		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	23753023, 34561554	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	23753023		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	15221005, 28187036, 31741706		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	27557495	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	30578313		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15621805, 8127874		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	37923249	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	31437238	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	24026482	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31042405, 31437238		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24174361		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	24174361	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19725836		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	23494182	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	21189159	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19421227, 22667760, 23204129, 30702467		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	19458358, 23753023, 23832765, 25574601, 26577686, 31122263, 38072417, 39684470	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	CTD_human_DG	26008977		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19458358, 25574601, 30480765, 37702821	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	21242189		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19421227, 19458358, 22667760, 29108241, 31708096		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	31758597		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	20198330		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	21693658		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	21693658	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	21693658		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19725153, 20112253, 20851183, 21150280, 21480320, 22745587, 22826617, 23842624, 26799423, 27671301, 28267710, 29423069, 29843122, 29843214, 29913237, 30246253, 30598500, 30836927, 31101236		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19668228, 21324136		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	34522226	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32457348, 9094972	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21293459, 23836654, 34080290, 35608130, 35871223, 36101745, 9094972	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23153503, 25557168		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36996699	Associate	★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	30912195		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	22648245		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22648245, 34967572	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15015605		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15015605	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18547964, 19452252, 29383095, 31186254		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	19452252, 23757039		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	18298903, 18547964, 19452252		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	18298903, 18547964, 19452252		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	21436619		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	31186254		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	22000864		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	22000864		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	20206440		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12082631, 16740723, 17369857, 21953073, 22309939, 22405092, 22465097, 22517885, 24626184, 24835992, 24876664, 25480943, 26171916, 27409838, 27558135, 28915707, 29288948, 29437878, 29493466, 30069007, 31072423		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18714168, 21170987, 22108192		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20112253, 21480320, 29843122		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15173270, 15569479, 22115795, 22248814, 23153503, 23836654, 26036843, 28557434, 30498349		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	20198330		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	19739117		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14970859, 25592872		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15141022, 22892842, 26090465, 27220401, 29295989, 29454093, 29749476, 29753186, 30933478		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15176053, 15661849, 16223707, 17265445, 21890624, 22065906, 22447658, 23659854, 24525428, 24771642, 25505174, 26364928, 26721726, 29716963, 31156720		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16440413, 16865274, 28843004, 29190933, 29954437, 30254463, 30288059, 30488440, 30655678		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15761500, 16837776, 21364537, 26876462, 27878946, 29246203, 30277841		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12082631, 12488480, 12527909, 15173270, 15176053, 15621805, 15805268, 16507989, 16557283, 16760651, 16865274, 16868416, 17265445, 17267659, 18056432, 18297112, 18714168, 19177004, 19452252, 19554017, 19591537, 20112253, 20347825, 20571075, 20655883, 21169242, 21189159, 21301227, 21545375, 21635870, 21637161, 21797676, 22262171, 22319201, 22667760, 22890557, 23153503, 23531193, 23659854, 23873848, 23887393, 23948487, 24271645, 24484936, 24810255, 24876664, 24929619, 25187488, 25537513, 25557168, 25592872, 25697066, 26024389, 26036843, 26317649, 26786872, 27109433, 27193833, 27220401, 27277815, 27330107, 27472164, 27558135, 27773673, 27793187, 27861885, 27888710, 27902479, 28102733, 28152267, 28360195, 28430578, 28512243, 28521657, 28638459, 28692064, 28708135, 28915707, 28953239, 29035889, 29048878, 29059161, 29067111, 29122685, 29186071, 29288948, 29402316, 29437878, 29605044, 29653924, 29687822, 29753186, 29899826, 29927572, 30042885, 30104712, 30254463, 30631355, 30647843, 30800581, 30836927, 30851646, 30859681, 30862113, 30899597, 31100782, 31571905, 31629162, 31708096, 7962193		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28556483		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27899378		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16052696, 16237758, 22753241, 22862168, 29549256		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21352579, 22405092, 24929619, 29067111		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	28416758		★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	21242189		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	16127294		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21652733, 22390279, 24019381, 28270075, 28283778, 30611741, 31541075		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	21652733, 22390279, 31541075, 34477871	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12082631, 19554017, 21654832, 26016894, 26854966, 27793694, 28235541, 28626898, 29282854, 31270153		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19554017, 19652546, 21654832, 24884503, 33177155, 36768289	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	34580349	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	24327015, 27840913	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	22479190		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	27906199, 35058575	Associate	★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	31758597		★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	22000864		★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	24026482, 35058575	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19996089, 21816470		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23584897	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36232761	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30782614, 31758597		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	37071125	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	31837568		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20145140, 27840977, 28401599, 31122263		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19739117, 30662640, 31281496		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	12082631		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11597015, 12154015, 14970859, 15160994, 15173270, 15176053, 15621805, 15766665, 15805268, 16223707, 16237758, 16557283, 16603252, 16645325, 16740723, 16865274, 16868416, 16945954, 17267659, 18714168, 18794363, 19177004, 19240714, 19572149, 19739117, 19801998, 19887553, 20112253, 20144850, 20581060, 21170987, 21187478, 21204585, 21436619, 21480320, 21637161, 21642374, 21797676, 21890624, 21965739, 22108192, 22319201, 22390279, 22405092, 22415968, 22648245, 22667760, 22745587, 23509868, 23531193, 23887393, 23948487, 24089139, 24265276, 24800640, 25189519, 25347426, 25382544, 25398439, 25480943, 25483104, 25557168, 25818805, 25826089, 26036843, 26364928, 26549165, 26799423, 27245623, 27557495, 27558135, 27647547, 28069876, 28102733, 28126323, 28138033, 28152267, 28270075, 28626898, 28628916, 28887496, 28900036, 28920432, 29067111, 29282854, 29402316, 29437878, 29483218, 29549256, 29686087, 29716963, 29913237, 30069007, 30118839, 30157470, 30217967, 30246253, 30288059, 30351497, 30498349, 30848278, 30862113, 30933478, 30991703, 31015177, 31281496, 31563561, 31571905, 8127874		★☆☆☆☆ Found in Text Mining only
Nephronophthisis familial juvenile	Nephronophthisis	Pubtator	22701722	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19887553, 21169242, 25917079, 26318737, 27773673, 28036269		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26046302	Associate	★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	22479190		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental disorder	Pubtator	35058575	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	28556483, 37837931	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	31758597		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12082631, 22064247, 23151088, 23531193, 25557168, 26549165, 26597303, 28628916, 28638459, 29040814, 29983892, 30859681, 31040125, 31548612, 31563561, 31595031, 31795121		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28648284		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	29652009	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36700234	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19725836, 19887553, 20144850, 21399492, 21822121, 24406311, 25193492, 27822032, 29100308, 31571905		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24566468, 27822032	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	29663364		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25592872		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14970859, 20073508, 21402713, 27557495, 29865033, 30851646, 32693821, 32886452, 35977930, 36142803	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	23659854		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15141022, 18266952, 22892842, 26090465, 27220401, 29295989, 29454093, 29749476, 29753186, 30933478		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15141022		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18266952, 26090465, 26091808, 30933478, 33000197, 35773310	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22892842	Stimulate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30915753		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28933595		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	35436627	Associate	★☆☆☆☆ Found in Text Mining only
Peroxisome biogenesis disorders	Zellweger Syndrome	BEFREE	31795214		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	31227645		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	19421227		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28684168		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	31837568		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15176053, 15661849, 16223707, 17265445, 21890624, 22065906, 22447658, 23531193, 23659854, 24525428, 24771642, 25505174, 26364928, 26721726, 29716963, 31156720, 31726756		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	17265445		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10660600, 22890325, 23661607, 24525428, 27557495, 29233929, 32704044, 33197890, 34198380, 34497666, 35305591, 37916740, 39201599	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15176053, 15661849		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	21890624, 24771642, 28069876		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22065906	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25252916	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	33416099	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	20146883		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31437238		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	31437238	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24174361		★☆☆☆☆ Found in Text Mining only
Radiation-Induced Cancer	Radiation-Induced Cancer	BEFREE	28900036		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20581060		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	23494182		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23494182, 24800640, 31186514		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	24366665, 26799423, 27647547, 28387346, 30374061		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	34901994	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	17699849		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	19887553, 25917079, 26024389, 31824851		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17434144		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	36435816	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	19652546, 38410032	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23592755, 27773673, 28212994, 30118839		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25198282, 26772203, 34397869	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	19004025		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20198330, 25826089, 30846478		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19004025, 19572149, 21610149, 22108192, 29339720, 29679654, 29959473, 30876762		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29652009, 34663837, 35756492, 37452322, 38536443	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28724602		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	21602893		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28126323		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16440413, 16645325, 16865274, 28843004, 29190933, 29954437, 30254463, 30288059, 30488440, 30655678		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16440413, 16630118, 26576650, 28430578, 29393385, 37265030	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16630118		★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	36627281	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	30814111		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	19452252		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	29843122	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30915753, 35838025	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	14735186		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	14735186		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14735186, 30243708		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	16127294		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22309939, 26264278, 27064522, 28138033, 29491053, 30996295, 31008565, 31751384		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22309939, 22405092, 30108112, 34967572, 36008466, 36627281, 40300663	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	30217967		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29246203, 36181054, 39456780	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	27174960		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19775446, 20622363	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	18353325	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	32602935	Associate	★☆☆☆☆ Found in Text Mining only