PLEK (pleckstrin)

Gene

• Entrez ID: 5341
• Gene name: Pleckstrin
• Gene symbol: PLEK
• Synonyms (NCBI Gene): P47, PLEK1
• Chromosome: 2
• Chromosome location: 2p14

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT532353	hsa-miR-3923	PAR-CLIP	22012620
MIRT532352	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT532351	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT532350	hsa-miR-5696	PAR-CLIP	22012620
MIRT532349	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT532348	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT532347	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT532346	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT532345	hsa-miR-183-3p	PAR-CLIP	22012620
MIRT532344	hsa-miR-4452	PAR-CLIP	22012620
MIRT532343	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT532342	hsa-miR-6875-3p	PAR-CLIP	22012620
MIRT532341	hsa-miR-4659a-3p	PAR-CLIP	22012620
MIRT532340	hsa-miR-4659b-3p	PAR-CLIP	22012620
MIRT532353	hsa-miR-3923	PAR-CLIP	22012620
MIRT532352	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT532351	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT532350	hsa-miR-5696	PAR-CLIP	22012620
MIRT532349	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT532348	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT532347	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT532346	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT532345	hsa-miR-183-3p	PAR-CLIP	22012620
MIRT532344	hsa-miR-4452	PAR-CLIP	22012620
MIRT532343	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT532342	hsa-miR-6875-3p	PAR-CLIP	22012620
MIRT532341	hsa-miR-4659a-3p	PAR-CLIP	22012620
MIRT532340	hsa-miR-4659b-3p	PAR-CLIP	22012620
MIRT1240704	hsa-miR-1229	CLIP-seq
MIRT1240705	hsa-miR-1343	CLIP-seq
MIRT1240706	hsa-miR-148a	CLIP-seq
MIRT1240707	hsa-miR-148b	CLIP-seq
MIRT1240708	hsa-miR-152	CLIP-seq
MIRT1240709	hsa-miR-3074-5p	CLIP-seq
MIRT1240710	hsa-miR-3124-3p	CLIP-seq
MIRT1240711	hsa-miR-3613-5p	CLIP-seq
MIRT1240712	hsa-miR-3690	CLIP-seq
MIRT1240713	hsa-miR-4254	CLIP-seq
MIRT1240714	hsa-miR-4493	CLIP-seq
MIRT1240715	hsa-miR-4650-5p	CLIP-seq
MIRT1240716	hsa-miR-4699-5p	CLIP-seq
MIRT1240717	hsa-miR-4709-3p	CLIP-seq
MIRT1240718	hsa-miR-4753-5p	CLIP-seq
MIRT1240719	hsa-miR-4757-5p	CLIP-seq
MIRT1240720	hsa-miR-579	CLIP-seq
MIRT1240721	hsa-miR-582-5p	CLIP-seq
MIRT1240722	hsa-miR-600	CLIP-seq
MIRT1240720	hsa-miR-579	CLIP-seq
MIRT1240720	hsa-miR-579	CLIP-seq
MIRT2070770	hsa-miR-4506	CLIP-seq
MIRT2297937	hsa-miR-1323	CLIP-seq
MIRT2297938	hsa-miR-2467-5p	CLIP-seq
MIRT2297939	hsa-miR-3188	CLIP-seq
MIRT2297940	hsa-miR-3975	CLIP-seq
MIRT2297941	hsa-miR-4649-3p	CLIP-seq
MIRT2297942	hsa-miR-485-5p	CLIP-seq
MIRT2297943	hsa-miR-539	CLIP-seq
MIRT2297944	hsa-miR-548o	CLIP-seq
MIRT2297945	hsa-miR-558	CLIP-seq
MIRT1240720	hsa-miR-579	CLIP-seq
MIRT2456632	hsa-miR-4330	CLIP-seq
MIRT2456633	hsa-miR-4749-3p	CLIP-seq
MIRT2595395	hsa-miR-1226	CLIP-seq
MIRT2595396	hsa-miR-197	CLIP-seq
MIRT2595397	hsa-miR-2682	CLIP-seq
MIRT2456632	hsa-miR-4330	CLIP-seq
MIRT2595398	hsa-miR-449c	CLIP-seq
MIRT2595399	hsa-miR-4514	CLIP-seq
MIRT2595400	hsa-miR-4645-5p	CLIP-seq
MIRT1240715	hsa-miR-4650-5p	CLIP-seq
MIRT2595401	hsa-miR-4673	CLIP-seq
MIRT2595402	hsa-miR-4692	CLIP-seq
MIRT2595403	hsa-miR-4733-3p	CLIP-seq
MIRT2456633	hsa-miR-4749-3p	CLIP-seq
MIRT2595395	hsa-miR-1226	CLIP-seq
MIRT2688060	hsa-miR-146a	CLIP-seq
MIRT2688061	hsa-miR-146b-5p	CLIP-seq
MIRT2595396	hsa-miR-197	CLIP-seq
MIRT2595397	hsa-miR-2682	CLIP-seq
MIRT2688062	hsa-miR-4434	CLIP-seq
MIRT2595398	hsa-miR-449c	CLIP-seq
MIRT2595399	hsa-miR-4514	CLIP-seq
MIRT2688063	hsa-miR-4516	CLIP-seq
MIRT2688064	hsa-miR-4531	CLIP-seq
MIRT2595400	hsa-miR-4645-5p	CLIP-seq
MIRT1240715	hsa-miR-4650-5p	CLIP-seq
MIRT2595401	hsa-miR-4673	CLIP-seq
MIRT2595402	hsa-miR-4692	CLIP-seq
MIRT1240716	hsa-miR-4699-5p	CLIP-seq
MIRT2595403	hsa-miR-4733-3p	CLIP-seq
MIRT2688065	hsa-miR-642a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEP	2768345
GO:0002576	Process	Platelet degranulation	IDA	7559487
GO:0002576	Process	Platelet degranulation	IEA
GO:0005080	Function	Protein kinase C binding	IDA	8615792
GO:0005515	Function	Protein binding	IPI	8999861, 19722192, 28514442, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IDA	8694752, 9060471
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0006904	Process	Vesicle docking involved in exocytosis	IEA
GO:0006904	Process	Vesicle docking involved in exocytosis	ISS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	10995449
GO:0010572	Process	Positive regulation of platelet activation	IEA
GO:0010572	Process	Positive regulation of platelet activation	ISS
GO:0010920	Process	Negative regulation of inositol phosphate biosynthetic process	IDA	7782310
GO:0016020	Component	Membrane	HDA	19946888
GO:0019211	Function	Phosphatase activator activity	IDA	8999861
GO:0030030	Process	Cell projection organization	IDA	9060471
GO:0030036	Process	Actin cytoskeleton organization	IBA
GO:0030036	Process	Actin cytoskeleton organization	IDA	10497244
GO:0030836	Process	Positive regulation of actin filament depolymerization	IDA	10497244
GO:0030836	Process	Positive regulation of actin filament depolymerization	IEA
GO:0030845	Process	Phospholipase C-inhibiting G protein-coupled receptor signaling pathway	IDA	7782310
GO:0030866	Process	Cortical actin cytoskeleton organization	IDA	10497244
GO:0031529	Process	Ruffle organization	IDA	10497244
GO:0032233	Process	Positive regulation of actin filament bundle assembly	IDA	10497244
GO:0032587	Component	Ruffle membrane	IDA	9060471
GO:0033625	Process	Positive regulation of integrin activation	IEA
GO:0033625	Process	Positive regulation of integrin activation	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	8694752
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IDA	15698571
GO:0043647	Process	Inositol phosphate metabolic process	IDA	8999861
GO:0044089	Process	Positive regulation of cellular component biogenesis	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IDA	7782310
GO:0050849	Process	Negative regulation of calcium-mediated signaling	NAS	8999861
GO:0060305	Process	Regulation of cell diameter	IDA	10995449
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IDA	7782310
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IEA
GO:0070495	Process	Negative regulation of thrombin-activated receptor signaling pathway	IDA	7559487
GO:0070527	Process	Platelet aggregation	HMP	23382103
GO:0070527	Process	Platelet aggregation	IEA
GO:0070527	Process	Platelet aggregation	ISS
GO:0070560	Process	Protein secretion by platelet	IEA
GO:0070560	Process	Protein secretion by platelet	ISS

Other IDs

• MIM: 173570
• HGNC: 9070
• e!Ensembl: ENSG00000115956

Protein

• UniProt ID: P08567
• Protein name: Pleckstrin (Platelet 47 kDa protein) (p47)
• Protein function: Major protein kinase C substrate of platelets.
• PDB: 1PLS, 1W4M, 1X05, 1XX0, 1ZM0, 2CSO, 2I5C, 2I5F
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	5 → 101	PH domain	Domain
  PF00610	DEP	139 → 219	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
  PF00169	PH	245 → 347	PH domain	Domain

• Sequence:

  MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQ
  DFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRL
  PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMI
  ASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEE
  FRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSV
  ESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK

• Sequence length: 350

Pathways

Reactome:

Platelet degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOLLICULAR LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aarskog syndrome	Aarskog Syndrome	BEFREE	10930571, 28587322		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	17599059		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	30837480		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	18079691		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	17654682	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	22982429	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26686060, 35087525	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis	Pubtator	26752647	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASDB_DG	21150878		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23884469		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33602227	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36653368	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASDB_DG	21383967		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34539672	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders Inherited	Blood coagulation disorder	Pubtator	8781424	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	8781424	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23237847, 25569504		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22179719	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36854280	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26686060, 35087525	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	37861500	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASCAT_DG	20190752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASDB_DG	20190752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	27015091	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Centronuclear myopathy	Centronuclear Myopathy	BEFREE	19932619, 19932620		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	16856148, 17636067, 19932620		★☆☆☆☆ Found in Text Mining only
Cherubism	Cherubism	BEFREE	17368082		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	26686060	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	15527168, 2398896		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	35087525	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22179719	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26686060	Stimulate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12681507	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12681507, 22179719, 24932611	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15626894		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	22111664		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28105508		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17579087	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28105508		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28011992		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21562756		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	26194181		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19491896, 19853286		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	29356177		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	18164066		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	34539672	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16314830, 21454620		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16314830, 21454620		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25737557		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	10452961, 10910929, 11684018, 11698128, 14688376, 21190454, 22311747, 23688784, 23826567, 9774399	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	37595341	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	9881709		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29078297		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	16532385	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	GWASDB_DG	21383967		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30559180, 9143921		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15626894		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	15626894		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18053070		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12009899, 17360849		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23237847, 25569504		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26053093, 26859676		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18783292		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17611497, 17918192, 18381585, 28008906		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	26686060	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11828257, 24121273		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	34922439	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36466903	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16575538, 24392697, 26137586, 29626488, 29738771, 29930380, 31040156		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21562756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oculocerebrorenal Syndrome	Oculocerebrorenal Syndrome	BEFREE	20133602		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18783292		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21782946		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35475466	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal kinesigenic choreoathetosis	Paroxysmal kinesigenic choreoathetosis	BEFREE	29356177		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	26334995, 26686060, 35087525	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	26686060		★☆☆☆☆ Found in Text Mining only
Poikiloderma of Kindler	Poikiloderma Of Kindler	BEFREE	12668616		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	22569241	Stimulate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	32947961	Stimulate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	12833524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	23155414	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	23155414		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29738771		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	38425243	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15626894		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25907251	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19389506		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	34922439	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	31420334, 37537391	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Williams Syndrome	Williams syndrome	Pubtator	16532385	Associate	★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	15082835, 7849006, 8939985		★☆☆☆☆ Found in Text Mining only