Gene Gene information from NCBI Gene database.
Entrez ID 53407
Gene name Syntaxin 18
Gene symbol STX18
Synonyms (NCBI Gene)
Ufe1
Chromosome 4
Chromosome location 4p16.3-p16.2
Summary This gene encodes a member of the syntaxin family of soluble N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs) which is part of a membrane tethering complex that includes other SNAREs and several peripheral membrane proteins, and is
miRNA miRNA information provided by mirtarbase database.
80
miRTarBase ID miRNA Experiments Reference
MIRT022496 hsa-miR-124-3p Microarray 18668037
MIRT1400576 hsa-miR-1324 CLIP-seq
MIRT1400577 hsa-miR-3121-5p CLIP-seq
MIRT1400578 hsa-miR-3974 CLIP-seq
MIRT1400579 hsa-miR-4302 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005484 Function SNAP receptor activity IEA
GO:0005515 Function Protein binding IPI 15029241, 15272311, 19369418, 28514442, 33961781, 35271311
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005783 Component Endoplasmic reticulum IDA 10788491
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606046 15942 ENSG00000168818
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P2W9
Protein name Syntaxin-18 (Cell growth-inhibiting gene 9 protein)
Protein function Syntaxin that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10496 Syntaxin-18_N 3 96 SNARE-complex protein Syntaxin-18 N-terminus Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHI
GKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQI
DQDAQIFMRTCSEAIQQLRTEAHK
EIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES
TSSEKVSQSPSKDSEENPATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQ
RLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGNE
DIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS
Sequence length 335
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  SNARE interactions in vesicular transport
Phagosome
  COPI-dependent Golgi-to-ER retrograde traffic
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SCOLIOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
ATRIAL SEPTAL DEFECT 1 Atrial Septal Defect BEFREE 23708191
★☆☆☆☆
Found in Text Mining only
Atrial Septal Defects Atrial Septal Defect BEFREE 23708191, 31712678
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 23708191
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 18722709
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Cognition disorder Pubtator 35240980 Associate
★☆☆☆☆
Found in Text Mining only
Congenital heart disease Congenital Heart Disease BEFREE 27816473
★☆☆☆☆
Found in Text Mining only
Coronary heart disease Coronary Heart Disease BEFREE 27816473
★☆☆☆☆
Found in Text Mining only
Heart Septal Defects Atrial Congenital heart septal defect Pubtator 31712678 Associate
★☆☆☆☆
Found in Text Mining only
Liver Failure, Acute Liver failure BEFREE 26541327
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 35668077 Associate
★☆☆☆☆
Found in Text Mining only