Gene Gene information from NCBI Gene database.
Entrez ID 5340
Gene name Plasminogen
Gene symbol PLG
Synonyms (NCBI Gene)
HAE4
Chromosome 6
Chromosome location 6q26
Summary The plasminogen protein encoded by this gene is a serine protease that circulates in blood plasma as an inactive zymogen and is converted to the active protease, plasmin, by several plasminogen activators such as tissue plasminogen activator (tPA), urokin
SNPs SNP information provided by dbSNP.
13
SNP ID Visualize variation Clinical significance Consequence
rs73015965 A>G Benign, pathogenic, pathogenic-likely-pathogenic Coding sequence variant, missense variant
rs121918027 G>A Conflicting-interpretations-of-pathogenicity, pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
rs121918028 G>T Pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
rs121918029 T>C Pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
rs121918030 G>A Pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
34
miRTarBase ID miRNA Experiments Reference
MIRT1242627 hsa-miR-1301 CLIP-seq
MIRT1242628 hsa-miR-181a CLIP-seq
MIRT1242629 hsa-miR-181b CLIP-seq
MIRT1242630 hsa-miR-181c CLIP-seq
MIRT1242631 hsa-miR-181d CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
SRF Activation 15514113
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
63
GO ID Ontology Definition Evidence Reference
GO:0002020 Function Protease binding IPI 7679575
GO:0004175 Function Endopeptidase activity IBA
GO:0004175 Function Endopeptidase activity IDA 7679575, 9603964
GO:0004252 Function Serine-type endopeptidase activity IDA 6447255, 14688145, 14699093, 17307854
GO:0004252 Function Serine-type endopeptidase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
173350 9071 ENSG00000122194
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P00747
Protein name Plasminogen (EC 3.4.21.7) [Cleaved into: Plasmin heavy chain A; Activation peptide; Angiostatin; Plasmin heavy chain A, short form; Plasmin light chain B]
Protein function Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian fo
PDB 1B2I , 1BML , 1BUI , 1CEA , 1CEB , 1DDJ , 1HPJ , 1HPK , 1I5K , 1KI0 , 1KRN , 1L4D , 1L4Z , 1PK4 , 1PKR , 1PMK , 1QRZ , 1RJX , 2DOH , 2DOI , 2KNF , 2L0S , 2PK4 , 3UIR , 4A5T , 4CIK , 4DCB , 4DUR , 4DUU , 5HPG , 5UGD , 5UGG , 6D3X , 6D3Y , 6D3Z , 6D40 , 6OG4 , 6OQJ , 6OQK , 6Q1U , 6UZ4 , 6UZ5 , 7E50 , 7THS , 7UAH , 8F7U , 8F7V , 8UQ6 , 9AZK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00024 PAN_1 23 99 PAN domain Domain
PF00051 Kringle 103 181 Kringle domain Domain
PF00051 Kringle 185 262 Kringle domain Domain
PF00051 Kringle 275 352 Kringle domain Domain
PF00051 Kringle 377 454 Kringle domain Domain
PF00051 Kringle 481 560 Kringle domain Domain
PF00089 Trypsin 581 803 Trypsin Domain
Tissue specificity TISSUE SPECIFICITY: Present in plasma and many other extracellular fluids. It is synthesized in the liver.
Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVY
LSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
C
EEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRC
TTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSC
DSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKC
SGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQC
AAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWI
EGVMRNN
Sequence length 810
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Staphylococcus aureus infection
Influenza A
  Platelet degranulation
Degradation of the extracellular matrix
Activation of Matrix Metalloproteinases
Signaling by PDGF
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Dissolution of Fibrin Clot
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
55
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Angioedema, hereditary, 4 Likely pathogenic; Pathogenic rs73015965, rs889957249, rs1582955358 RCV005042050
RCV001507288
RCV001507289
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Deep venous thrombosis Likely pathogenic; Pathogenic rs73015965 RCV002221996
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dysplasminogenemia Pathogenic rs121918028, rs121918029 RCV000014543
RCV000014544
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary angioedema with normal C1Inh Pathogenic rs1582955358 RCV001027412
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Abnormal bleeding Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANGIOEDEMAS, HEREDITARY Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATYPICAL HEMOLYTIC UREMIC SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Atypical hemolytic-uremic syndrome Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
AA amyloidosis AA amyloidosis BEFREE 29520774
★☆☆☆☆
Found in Text Mining only
Activated Protein C Resistance Activated Protein C Resistance BEFREE 10650845, 15609280, 21225090, 9439545, 9544982
★☆☆☆☆
Found in Text Mining only
Acute Cerebrovascular Accidents Stroke BEFREE 18662099
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome BEFREE 9544737
★☆☆☆☆
Found in Text Mining only
Acute Kidney Insufficiency Acute Kidney Insufficiency CTD_human_DG 28885000
★☆☆☆☆
Found in Text Mining only
Acute Kidney Tubular Necrosis Renal tubular necrosis BEFREE 8943484
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 29852400
★☆☆☆☆
Found in Text Mining only
Acute pancreatitis Pancreatitis BEFREE 31774228
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 10099141, 12165291, 28687976
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 15515049, 1850957, 1855221, 7664291
★☆☆☆☆
Found in Text Mining only