PLD2 (phospholipase D2)

Gene

• Entrez ID: 5338
• Gene name: Phospholipase D2
• Gene symbol: PLD2
• Synonyms (NCBI Gene): PLD1C
• Chromosome: 17
• Chromosome location: 17p13.2
• Summary: The protein encoded by this gene catalyzes the hydrolysis of phosphatidylcholine to phosphatidic acid and choline. The activity of the encoded enzyme is enhanced by phosphatidylinositol 4,5-bisphosphate and ADP-ribosylation factor-1. This protein localize

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT054650	hsa-miR-203a-3p	Immunofluorescence, Luciferase reporter assay, Western blot	26787840
MIRT1240253	hsa-miR-1291	CLIP-seq
MIRT1240254	hsa-miR-1302	CLIP-seq
MIRT1240255	hsa-miR-1470	CLIP-seq
MIRT1240256	hsa-miR-1587	CLIP-seq
MIRT1240257	hsa-miR-3119	CLIP-seq
MIRT1240258	hsa-miR-3192	CLIP-seq
MIRT1240259	hsa-miR-3591-5p	CLIP-seq
MIRT1240260	hsa-miR-362-5p	CLIP-seq
MIRT1240261	hsa-miR-3667-3p	CLIP-seq
MIRT1240262	hsa-miR-3689a-3p	CLIP-seq
MIRT1240263	hsa-miR-3689c	CLIP-seq
MIRT1240264	hsa-miR-3908	CLIP-seq
MIRT1240265	hsa-miR-4292	CLIP-seq
MIRT1240266	hsa-miR-4298	CLIP-seq
MIRT1240267	hsa-miR-4492	CLIP-seq
MIRT1240268	hsa-miR-4498	CLIP-seq
MIRT1240269	hsa-miR-4505	CLIP-seq
MIRT1240270	hsa-miR-4656	CLIP-seq
MIRT1240271	hsa-miR-4667-3p	CLIP-seq
MIRT1240272	hsa-miR-4675	CLIP-seq
MIRT1240273	hsa-miR-4728-5p	CLIP-seq
MIRT1240274	hsa-miR-4741	CLIP-seq
MIRT1240275	hsa-miR-500b	CLIP-seq
MIRT1240276	hsa-miR-501-5p	CLIP-seq
MIRT1240277	hsa-miR-520d-5p	CLIP-seq
MIRT1240278	hsa-miR-524-5p	CLIP-seq
MIRT1240279	hsa-miR-642a	CLIP-seq
MIRT1240280	hsa-miR-762	CLIP-seq
MIRT1240281	hsa-miR-885-3p	CLIP-seq
MIRT1240282	hsa-miR-887	CLIP-seq
MIRT2070659	hsa-miR-1255a	CLIP-seq
MIRT2070660	hsa-miR-1255b	CLIP-seq
MIRT2070661	hsa-miR-1909	CLIP-seq
MIRT2070662	hsa-miR-3670	CLIP-seq
MIRT2070663	hsa-miR-4525	CLIP-seq
MIRT2070664	hsa-miR-556-5p	CLIP-seq
MIRT2297809	hsa-miR-1285	CLIP-seq
MIRT2297810	hsa-miR-138	CLIP-seq
MIRT2297811	hsa-miR-140-5p	CLIP-seq
MIRT1240255	hsa-miR-1470	CLIP-seq
MIRT1240256	hsa-miR-1587	CLIP-seq
MIRT2297812	hsa-miR-214	CLIP-seq
MIRT2297813	hsa-miR-3187-5p	CLIP-seq
MIRT1240258	hsa-miR-3192	CLIP-seq
MIRT1240264	hsa-miR-3908	CLIP-seq
MIRT2297814	hsa-miR-4270	CLIP-seq
MIRT2297815	hsa-miR-4279	CLIP-seq
MIRT2297816	hsa-miR-4325	CLIP-seq
MIRT2297817	hsa-miR-4441	CLIP-seq
MIRT1240267	hsa-miR-4492	CLIP-seq
MIRT1240268	hsa-miR-4498	CLIP-seq
MIRT1240269	hsa-miR-4505	CLIP-seq
MIRT1240270	hsa-miR-4656	CLIP-seq
MIRT1240271	hsa-miR-4667-3p	CLIP-seq
MIRT1240272	hsa-miR-4675	CLIP-seq
MIRT1240274	hsa-miR-4741	CLIP-seq
MIRT2297818	hsa-miR-507	CLIP-seq
MIRT1240277	hsa-miR-520d-5p	CLIP-seq
MIRT1240278	hsa-miR-524-5p	CLIP-seq
MIRT2297819	hsa-miR-557	CLIP-seq
MIRT2297820	hsa-miR-612	CLIP-seq
MIRT1240279	hsa-miR-642a	CLIP-seq
MIRT2297821	hsa-miR-761	CLIP-seq
MIRT1240280	hsa-miR-762	CLIP-seq
MIRT1240281	hsa-miR-885-3p	CLIP-seq
MIRT1240282	hsa-miR-887	CLIP-seq
MIRT1240253	hsa-miR-1291	CLIP-seq
MIRT1240254	hsa-miR-1302	CLIP-seq
MIRT2456629	hsa-miR-1321	CLIP-seq
MIRT2297814	hsa-miR-4270	CLIP-seq
MIRT1240265	hsa-miR-4292	CLIP-seq
MIRT1240266	hsa-miR-4298	CLIP-seq
MIRT2297817	hsa-miR-4441	CLIP-seq
MIRT1240273	hsa-miR-4728-5p	CLIP-seq
MIRT2456630	hsa-miR-4739	CLIP-seq
MIRT2456631	hsa-miR-4756-5p	CLIP-seq
MIRT2297809	hsa-miR-1285	CLIP-seq
MIRT2070661	hsa-miR-1909	CLIP-seq
MIRT2297812	hsa-miR-214	CLIP-seq
MIRT2297813	hsa-miR-3187-5p	CLIP-seq
MIRT2297816	hsa-miR-4325	CLIP-seq
MIRT2070663	hsa-miR-4525	CLIP-seq
MIRT2297818	hsa-miR-507	CLIP-seq
MIRT2297819	hsa-miR-557	CLIP-seq
MIRT2297820	hsa-miR-612	CLIP-seq
MIRT2297821	hsa-miR-761	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002031	Process	G protein-coupled receptor internalization	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004630	Function	Phospholipase D activity	IBA
GO:0004630	Function	Phospholipase D activity	IEA
GO:0004630	Function	Phospholipase D activity	TAS	9582313
GO:0005515	Function	Protein binding	IPI	16407827, 17276458, 17853892, 22106281, 32814053
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9395408
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006654	Process	Phosphatidic acid biosynthetic process	IEA
GO:0006654	Process	Phosphatidic acid biosynthetic process	TAS
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0007010	Process	Cytoskeleton organization	TAS	9395408
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	TAS	9582313
GO:0009395	Process	Phospholipid catabolic process	IBA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031526	Component	Brush border membrane	IEA
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0036465	Process	Synaptic vesicle recycling	TAS	24252804
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0060627	Process	Regulation of vesicle-mediated transport	IBA
GO:0098793	Component	Presynapse	IEA

Other IDs

• MIM: 602384
• HGNC: 9068
• e!Ensembl: ENSG00000129219

Protein

• UniProt ID: O14939
• Protein name: Phospholipase D2 (PLD 2) (hPLD2) (EC 3.1.4.4) (Choline phosphatase 2) (PLD1C) (Phosphatidylcholine-hydrolyzing phospholipase D2)
• Protein function: Function as phospholipase selective for phosphatidylcholine (PubMed:9582313). May have a role in signal-induced cytoskeletal regulation and/or endocytosis (By similarity).
• PDB: 6OHM, 6OHO, 6OHP, 6OHQ, 6OHS, 7SVP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00787	PX	90 → 192	PX domain	Domain
  PF00614	PLDc	437 → 464	Phospholipase D Active site motif	Family
  PF13091	PLDc_2	626 → 802	PLD-like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9582313}.
• Sequence:

  MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFA
  PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVL
  MSLLPLARFAVAYSPARDAGNREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYR
  NYHAMTEFLEVSQLSFIPDLGRKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
  KDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQAR
  WWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIF
  ITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRAL
  MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
  SAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
  RDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQ
  CTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDE
  IVDRILKAHKQGWCYRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
  LKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKVLIADDRTVIIGSANINDRSLL
  GKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFGVILGANTRPDLDLRDPICD
  DFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQ
  GHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT

• Sequence length: 933

Pathways

KEGG:

Glycerophospholipid metabolism
Ether lipid metabolism
Metabolic pathways
Ras signaling pathway
cAMP signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Endocytosis
Fc gamma R-mediated phagocytosis
Glutamatergic synapse
GnRH signaling pathway
Parathyroid hormone synthesis, secretion and action
Pathways in cancer
Chemical carcinogenesis - reactive oxygen species
Pancreatic cancer
Choline metabolism in cancer

Reactome:

Synthesis of PA
Role of phospholipids in phagocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Actinic keratosis	Actinic keratosis	BEFREE	28656282		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	20429620		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	21400035	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17640750		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	17640750		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	17640750	Associate	★☆☆☆☆ Found in Text Mining only
Bowen's Disease		Pubtator	28656282	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	30555342		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23752189, 27851813, 28011629, 29033361		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22960035, 23238254, 23989060	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26781944	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31673104	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28087476		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21400035	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28656282	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30207376		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	21147981		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28484281		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26614430, 30091007, 30305726		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30305726		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12601529, 17914593, 25475140		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12601529, 17914593		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21944249, 25475140	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29660846		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	15330336		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24257753		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32074974	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24257753		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25523098		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28831159		★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	BEFREE	21308979		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17640750	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21147981		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	22094461	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33927069	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26502338		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	33927069	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	10553072		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	18523140		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23752189, 27851813, 28011629, 29033361		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31673104		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21414324, 23238254, 25532944, 29674728, 31673104		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26614430, 30091007, 30305726		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28831159		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23752189, 26781944		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28831159		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15919668, 23752189, 24947526, 26614430, 29660846, 29674728, 30305726		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36362078	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	40124273	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18498667		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15033366, 29526688		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31673104		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31673104	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	21400035	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29660846		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	24947526		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	15919668		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	15919668	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	21400035	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28656282		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	18498667	Associate	★☆☆☆☆ Found in Text Mining only