Gene Gene information from NCBI Gene database.
Entrez ID 53373
Gene name Two pore segment channel 1
Gene symbol TPCN1
Synonyms (NCBI Gene)
TPC1
Chromosome 12
Chromosome location 12q24.13
Summary Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6 (Ishibashi et al., 2000 [PubMed 10753632]).[supplied by
miRNA miRNA information provided by mirtarbase database.
152
miRTarBase ID miRNA Experiments Reference
MIRT018931 hsa-miR-335-5p Microarray 18185580
MIRT046365 hsa-miR-23b-3p CLASH 23622248
MIRT1448962 hsa-miR-1321 CLIP-seq
MIRT1448963 hsa-miR-137 CLIP-seq
MIRT1448964 hsa-miR-153 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
48
GO ID Ontology Definition Evidence Reference
GO:0005216 Function Monoatomic ion channel activity IEA
GO:0005248 Function Voltage-gated sodium channel activity IDA 24776928
GO:0005248 Function Voltage-gated sodium channel activity IEA
GO:0005262 Function Calcium channel activity IEA
GO:0005515 Function Protein binding IPI 15094197, 21903581, 24188827
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609666 18182 ENSG00000186815
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9ULQ1
Protein name Two pore channel protein 1 (Two pore calcium channel protein 1) (Voltage-dependent calcium channel protein TPC1)
Protein function Intracellular channel initially characterized as a non-selective Ca(2+)-permeable channel activated by NAADP (nicotinic acid adenine dinucleotide phosphate), it is also a voltage-gated highly-selective Na(+) channel activated directly by PI(3,5)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00520 Ion_trans 105 331 Ion transport protein Family
PF00520 Ion_trans 440 694 Ion transport protein Family
Tissue specificity TISSUE SPECIFICITY: Highest expression found in the heart and kidney, and lowest expression found in the spleen. {ECO:0000269|PubMed:10574461}.
Sequence
MAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQAPSLSSGGESSP
SSPAHNWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
LLSLCEAPAVPALRLGIYVHATLELFALMVVVFELCMKLRWLGLHTFIRHKRTMVKTSVL
VVQFVEAIVVLVRQMSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQSLPPFMDILLLLL
FFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLLTTANFPDVMMPSYSRNPWSCVFF
IVYLSIELYFIMNLLLAVVFDTFNDIEKRKF
KSLLLHKRTAIQHAYRLLISQRRPAGISY
RQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWF
DELPRTALLIFKGINILVKSKAFQYFMYLVVAVNGVWILVETFMLKGGNFFSKHVPWSYL
VFLTIYGVELFLKVAGLGPVEYLSSGWNLFDFSVTVFAFLGLLALALNMEPFYFIVVLRP
LQLLRLFKLKERYRNVLDTMFELLPRMASLGLTLLIFYYSFAIVGMEFFCGIVFPNCCNT
STVADAYRWRNHTVGNRTVVEEGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQT
SHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRM
NYSRKNQDSEVDGGITLEKEISKEEL
VAVLELYREARGASSDVTRLLETLSQMERYQQHSMVFLGRRSRTKSDLSLKMYQEEIQEW
YEEHAREQEQQRQLSSSAAPAAQQPPGSRQRSQTVT
Sequence length 816
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Calcium signaling pathway   Stimuli-sensing channels
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
20
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 36191742 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Anaplastic thyroid carcinoma Anaplastic thyroid cancer BEFREE 27151833
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 37649101 Associate
★☆☆☆☆
Found in Text Mining only
B-Cell Lymphomas B-Cell Lymphoma BEFREE 28808482, 31410148
★☆☆☆☆
Found in Text Mining only
Cardiomyopathies Cardiomyopathy Pubtator 32037394 Associate
★☆☆☆☆
Found in Text Mining only
Cardiovascular Diseases Cardiovascular Diseases BEFREE 27966485
★☆☆☆☆
Found in Text Mining only
Congestive heart failure Congestive Heart Failure BEFREE 22701570
★☆☆☆☆
Found in Text Mining only
Differentiated Thyroid Gland Carcinoma Thyroid Carcinoma BEFREE 28808482
★☆☆☆☆
Found in Text Mining only
Follicular thyroid carcinoma Follicular Thyroid Carcinoma BEFREE 24797369, 27151833
★☆☆☆☆
Found in Text Mining only
Glioma Glioma BEFREE 25553100
★☆☆☆☆
Found in Text Mining only