Gene Gene information from NCBI Gene database.
Entrez ID 53371
Gene name Nucleoporin 54
Gene symbol NUP54
Synonyms (NCBI Gene)
DYT37
Chromosome 4
Chromosome location 4q21.1
Summary The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules
miRNA miRNA information provided by mirtarbase database.
235
miRTarBase ID miRNA Experiments Reference
MIRT016625 hsa-miR-484 Sequencing 20371350
MIRT030464 hsa-miR-24-3p Sequencing 20371350
MIRT030464 hsa-miR-24-3p Microarray 19748357
MIRT506351 hsa-miR-19a-3p HITS-CLIP 21572407
MIRT506350 hsa-miR-19b-3p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 21516116, 21994455, 25416956, 26496610, 27194810, 30021884, 31413325, 31515488, 32296183, 32353859, 32814053, 33060197, 33961781, 35271311, 36217030
GO:0005634 Component Nucleus IEA
GO:0005635 Component Nuclear envelope IDA 24315095
GO:0005635 Component Nuclear envelope IEA
GO:0005635 Component Nuclear envelope TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607607 17359 ENSG00000138750
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z3B4
Protein name Nucleoporin p54 (54 kDa nucleoporin)
Protein function Component of the nuclear pore complex, a complex required for the trafficking across the nuclear membrane.
PDB 4JNU , 4JNV , 4JO7 , 4JO9 , 5IJN , 5IJO , 7N8R , 7PER , 7R5J , 7R5K
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13874 Nup54 300 438 Nucleoporin complex subunit 54 Domain
PF18437 Nup54_C 453 491 Nup54 C-terminal interacting domain Domain
Sequence
MAFNFGAPSGTSGTAAATAAPAGGFGGFGTTSTTAGSAFSFSAPTNTGTTGLFGGTQNKG
FGFGTGFGTTTGTSTGLGTGLGTGLGFGGFNTQQQQQTTLGGLFSQPTQAPTQSNQLINT
ASALSAPTLLGDERDAILAKWNQLQAFWGTGKGYFNNNIPPVEFTQENPFCRFKAVGYSC
MPSNKDEDGLVVLVFNKKETEIRSQQQQLVESLHKVLGGNQTLTVNVEGTKTLPDDQTEV
VIYVVERSPNGTSRRVPATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQLLQNP
PAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTRLDIISEDISE
LQKNQTTSVAKIAQYKRKLMDLSHRTLQVLIKQEIQRKSGYAIQADEEQLRVQLDTIQGE
LNAPTQFKGRLNELMSQI
RMQNHFGAVRSEERYYIDADLLREIKQHLKQQQEGLSHLISI
IKDDLEDIKLV
EHGLNETIHIRGGVFS
Sequence length 507
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Nucleocytoplasmic transport
Amyotrophic lateral sclerosis
  ISG15 antiviral mechanism
Transport of the SLBP independent Mature mRNA
Transport of the SLBP Dependant Mature mRNA
Transport of Mature mRNA Derived from an Intronless Transcript
Transport of Mature mRNA derived from an Intron-Containing Transcript
Rev-mediated nuclear export of HIV RNA
Transport of Ribonucleoproteins into the Host Nucleus
NS1 Mediated Effects on Host Pathways
Viral Messenger RNA Synthesis
NEP/NS2 Interacts with the Cellular Export Machinery
Regulation of Glucokinase by Glucokinase Regulatory Protein
Vpr-mediated nuclear import of PICs
snRNP Assembly
SUMOylation of DNA damage response and repair proteins
SUMOylation of ubiquitinylation proteins
Nuclear Pore Complex (NPC) Disassembly
Regulation of HSF1-mediated heat shock response
SUMOylation of SUMOylation proteins
SUMOylation of chromatin organization proteins
SUMOylation of RNA binding proteins
SUMOylation of DNA replication proteins
Transcriptional regulation by small RNAs
Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
tRNA processing in the nucleus
HCMV Early Events
HCMV Late Events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Dystonia 37, early-onset, with striatal lesions Pathogenic rs776306424, rs765028638, rs758229208 RCV003236960
RCV003236961
RCV003236962
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
METABOLIC SYNDROME GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Congenital chromosomal disease Congenital Chromosomal Disease BEFREE 29986057
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 20419844
★☆☆☆☆
Found in Text Mining only