SPA17 (sperm autoantigenic protein 17)

Gene

• Entrez ID: 53340
• Gene name: Sperm autoantigenic protein 17
• Gene symbol: SPA17
• Synonyms (NCBI Gene): CT22, SP17, SP17-1
• Chromosome: 11
• Chromosome location: 11q24.2
• Summary: This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central por

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT720634	hsa-miR-5003-3p	HITS-CLIP	19536157
MIRT720635	hsa-miR-3190-5p	HITS-CLIP	19536157
MIRT720633	hsa-miR-3926	HITS-CLIP	19536157
MIRT720632	hsa-miR-548s	HITS-CLIP	19536157
MIRT708560	hsa-miR-5196-3p	HITS-CLIP	19536157
MIRT708559	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT708558	hsa-miR-6072	HITS-CLIP	19536157
MIRT708557	hsa-miR-6891-3p	HITS-CLIP	19536157
MIRT708556	hsa-miR-5193	HITS-CLIP	19536157
MIRT708555	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT708554	hsa-miR-6870-3p	HITS-CLIP	19536157
MIRT708553	hsa-miR-4674	HITS-CLIP	19536157
MIRT708552	hsa-miR-1587	HITS-CLIP	19536157
MIRT708551	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT708550	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT708549	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT525989	hsa-miR-3154	PAR-CLIP	22012620
MIRT525988	hsa-miR-3126-3p	PAR-CLIP	22012620
MIRT525987	hsa-miR-1298-3p	PAR-CLIP	22012620
MIRT525986	hsa-miR-3668	PAR-CLIP	22012620
MIRT525985	hsa-miR-4638-3p	PAR-CLIP	22012620
MIRT525984	hsa-miR-378a-3p	PAR-CLIP	22012620
MIRT525983	hsa-miR-378b	PAR-CLIP	22012620
MIRT525982	hsa-miR-378c	PAR-CLIP	22012620
MIRT525981	hsa-miR-378d	PAR-CLIP	22012620
MIRT525980	hsa-miR-378e	PAR-CLIP	22012620
MIRT525979	hsa-miR-378f	PAR-CLIP	22012620
MIRT525978	hsa-miR-378h	PAR-CLIP	22012620
MIRT525977	hsa-miR-378i	PAR-CLIP	22012620
MIRT525976	hsa-miR-422a	PAR-CLIP	22012620
MIRT525975	hsa-miR-3171	PAR-CLIP	22012620
MIRT525974	hsa-miR-6861-3p	PAR-CLIP	22012620
MIRT525973	hsa-miR-492	PAR-CLIP	22012620
MIRT525972	hsa-miR-659-5p	PAR-CLIP	22012620
MIRT525971	hsa-miR-3935	PAR-CLIP	22012620
MIRT525970	hsa-miR-376a-2-5p	PAR-CLIP	22012620
MIRT525969	hsa-miR-4535	PAR-CLIP	22012620
MIRT720634	hsa-miR-5003-3p	HITS-CLIP	19536157
MIRT720635	hsa-miR-3190-5p	HITS-CLIP	19536157
MIRT720633	hsa-miR-3926	HITS-CLIP	19536157
MIRT720632	hsa-miR-548s	HITS-CLIP	19536157
MIRT708560	hsa-miR-5196-3p	HITS-CLIP	19536157
MIRT708559	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT708558	hsa-miR-6072	HITS-CLIP	19536157
MIRT708557	hsa-miR-6891-3p	HITS-CLIP	19536157
MIRT708556	hsa-miR-5193	HITS-CLIP	19536157
MIRT708555	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT708554	hsa-miR-6870-3p	HITS-CLIP	19536157
MIRT708553	hsa-miR-4674	HITS-CLIP	19536157
MIRT708552	hsa-miR-1587	HITS-CLIP	19536157
MIRT708551	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT708550	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT708549	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT615246	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT615245	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT615244	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT615243	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT525989	hsa-miR-3154	PAR-CLIP	22012620
MIRT525988	hsa-miR-3126-3p	PAR-CLIP	22012620
MIRT525987	hsa-miR-1298-3p	PAR-CLIP	22012620
MIRT525986	hsa-miR-3668	PAR-CLIP	22012620
MIRT525985	hsa-miR-4638-3p	PAR-CLIP	22012620
MIRT525984	hsa-miR-378a-3p	PAR-CLIP	22012620
MIRT525983	hsa-miR-378b	PAR-CLIP	22012620
MIRT525982	hsa-miR-378c	PAR-CLIP	22012620
MIRT525981	hsa-miR-378d	PAR-CLIP	22012620
MIRT525980	hsa-miR-378e	PAR-CLIP	22012620
MIRT525979	hsa-miR-378f	PAR-CLIP	22012620
MIRT525978	hsa-miR-378h	PAR-CLIP	22012620
MIRT525977	hsa-miR-378i	PAR-CLIP	22012620
MIRT525976	hsa-miR-422a	PAR-CLIP	22012620
MIRT525975	hsa-miR-3171	PAR-CLIP	22012620
MIRT525974	hsa-miR-6861-3p	PAR-CLIP	22012620
MIRT525973	hsa-miR-492	PAR-CLIP	22012620
MIRT525972	hsa-miR-659-5p	PAR-CLIP	22012620
MIRT525971	hsa-miR-3935	PAR-CLIP	22012620
MIRT525970	hsa-miR-376a-2-5p	PAR-CLIP	22012620
MIRT525969	hsa-miR-4535	PAR-CLIP	22012620
MIRT1381639	hsa-miR-3976	CLIP-seq
MIRT1381640	hsa-miR-4709-5p	CLIP-seq
MIRT1381641	hsa-miR-5096	CLIP-seq
MIRT1381642	hsa-miR-513b	CLIP-seq
MIRT1381643	hsa-miR-579	CLIP-seq
MIRT1381644	hsa-miR-664	CLIP-seq
MIRT1381642	hsa-miR-513b	CLIP-seq
MIRT1381642	hsa-miR-513b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003351	Process	Epithelial cilium movement involved in extracellular fluid movement	NAS	18421703
GO:0005515	Function	Protein binding	IPI	15257753, 17551920, 25416956, 25910212, 28514442, 32296183, 33961781
GO:0005516	Function	Calmodulin binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18421703
GO:0005737	Component	Cytoplasm	IEA
GO:0005929	Component	Cilium	IDA	18421703
GO:0005929	Component	Cilium	IEA
GO:0007283	Process	Spermatogenesis	TAS	8688458
GO:0007338	Process	Single fertilization	IEA
GO:0007338	Process	Single fertilization	TAS	8688458
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0031514	Component	Motile cilium	IDA	18421703
GO:0035686	Component	Sperm fibrous sheath	IBA
GO:0035686	Component	Sperm fibrous sheath	IDA	19604394
GO:0035686	Component	Sperm fibrous sheath	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0097228	Component	Sperm principal piece	IBA
GO:0097228	Component	Sperm principal piece	IDA	15257753
GO:0097228	Component	Sperm principal piece	IEA

Other IDs

• MIM: 608621
• HGNC: 11210
• e!Ensembl: ENSG00000064199

Protein

• UniProt ID: Q15506
• Protein name: Sperm surface protein Sp17 (Cancer/testis antigen 22) (CT22) (Sp17-1) (Sperm autoantigenic protein 17) (Sperm protein 17)
• Protein function: Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates (By similarity).
• PDB: 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02197	RIIa	14 → 51	Regulatory subunit of type II PKA R-subunit	Domain
  PF00612	IQ	115 → 135	IQ calmodulin-binding motif	Motif

• Tissue specificity: TISSUE SPECIFICITY: Testis and sperm specific.
• Sequence:

  MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEW
  GSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK
  IQAAFRGHIAREEAKKMKTNSLQNEEKEENK

• Sequence length: 151

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	24103781, 30309325		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	17309563, 30309325		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12739786	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29088794, 31417875		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19685492	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23923079	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26300426		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19744347, 30309325	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37533202	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12015770, 17309563, 17336323, 19744347, 29504239, 30127274, 30309325		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	20712874		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	20712874		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20712874, 27618037		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27618037	Stimulate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17309563, 19744347, 30127274, 30309325		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17230514		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17230514		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	17230514		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19685492	Stimulate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	17551920		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	31336797	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	31417875		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25739119	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29088794, 31417875		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20712874		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17230514, 29088794		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26300426		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12015770, 17309563, 17336323, 29504239		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	11222401, 12213290, 29088794, 30127274, 31218705		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12213290, 17309563, 19685492, 20712874, 24811209, 30309325		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	20712874		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29088794		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	31218705		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11222401, 11477539, 12015770, 15381930, 29245977		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11222401, 12015770, 12130509, 15381930, 16438728	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28337274		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11477539, 11568003, 12015770, 12213290, 20712874, 25739119, 27618037, 29245977, 29504239, 30127274		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24103781, 25739119, 26300426, 29245977		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	31417875		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	12015770, 17336323		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	19744347	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	14712480, 17309563, 29504239, 30309325		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	14712480		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12015770, 16438728	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	25739119		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12739786		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	17336323		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17230514		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29245977		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	24103781	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29088794		★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	27618037		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	27618037	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	33463119	Associate	★☆☆☆☆ Found in Text Mining only