PLAUR (plasminogen activator, urokinase receptor)

Gene

• Entrez ID: 5329
• Gene name: Plasminogen activator, urokinase receptor
• Gene symbol: PLAUR
• Synonyms (NCBI Gene): CD87, U-PAR, UPAR, URKR
• Chromosome: 19
• Chromosome location: 19q13.31
• Summary: This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized deg

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005839	hsa-miR-204-5p	Microarray	21282569
MIRT020661	hsa-miR-155-5p	Proteomics	18668040
MIRT031606	hsa-miR-16-5p	Proteomics	18668040
MIRT1239464	hsa-miR-1200	CLIP-seq
MIRT1239465	hsa-miR-1208	CLIP-seq
MIRT1239466	hsa-miR-3074-3p	CLIP-seq
MIRT1239467	hsa-miR-335	CLIP-seq
MIRT1239468	hsa-miR-3545-3p	CLIP-seq
MIRT1239469	hsa-miR-3670	CLIP-seq
MIRT1239470	hsa-miR-3929	CLIP-seq
MIRT1239471	hsa-miR-4324	CLIP-seq
MIRT1239472	hsa-miR-4419b	CLIP-seq
MIRT1239473	hsa-miR-4423-5p	CLIP-seq
MIRT1239474	hsa-miR-4478	CLIP-seq
MIRT1239475	hsa-miR-4635	CLIP-seq
MIRT1239476	hsa-miR-4659a-3p	CLIP-seq
MIRT1239477	hsa-miR-4659b-3p	CLIP-seq
MIRT1239478	hsa-miR-4680-5p	CLIP-seq
MIRT1239479	hsa-miR-4684-5p	CLIP-seq
MIRT1239480	hsa-miR-544b	CLIP-seq
MIRT1239481	hsa-miR-892a	CLIP-seq
MIRT1239482	hsa-miR-942	CLIP-seq
MIRT2070427	hsa-miR-103b	CLIP-seq
MIRT2070428	hsa-miR-1236	CLIP-seq
MIRT2070429	hsa-miR-127-3p	CLIP-seq
MIRT2070430	hsa-miR-3167	CLIP-seq
MIRT2070431	hsa-miR-3202	CLIP-seq
MIRT2070432	hsa-miR-377	CLIP-seq
MIRT2070433	hsa-miR-3936	CLIP-seq
MIRT2070434	hsa-miR-4436b-3p	CLIP-seq
MIRT2070435	hsa-miR-4450	CLIP-seq
MIRT2070436	hsa-miR-4525	CLIP-seq
MIRT2070437	hsa-miR-4685-5p	CLIP-seq
MIRT2070438	hsa-miR-4716-3p	CLIP-seq
MIRT2070439	hsa-miR-4747-5p	CLIP-seq
MIRT2070440	hsa-miR-4753-3p	CLIP-seq
MIRT2070441	hsa-miR-4768-5p	CLIP-seq
MIRT2070442	hsa-miR-615-5p	CLIP-seq
MIRT2070443	hsa-miR-876-5p	CLIP-seq
MIRT2070432	hsa-miR-377	CLIP-seq
MIRT2392613	hsa-miR-3137	CLIP-seq
MIRT2392614	hsa-miR-3158-3p	CLIP-seq
MIRT2392615	hsa-miR-3192	CLIP-seq
MIRT2070432	hsa-miR-377	CLIP-seq
MIRT2392616	hsa-miR-4300	CLIP-seq
MIRT2392617	hsa-miR-4446-3p	CLIP-seq
MIRT2392618	hsa-miR-4492	CLIP-seq
MIRT2392619	hsa-miR-4498	CLIP-seq
MIRT2392620	hsa-miR-4505	CLIP-seq
MIRT2392621	hsa-miR-4537	CLIP-seq
MIRT2392622	hsa-miR-762	CLIP-seq
MIRT2392623	hsa-miR-920	CLIP-seq
MIRT2070427	hsa-miR-103b	CLIP-seq
MIRT2070428	hsa-miR-1236	CLIP-seq
MIRT2439517	hsa-miR-193a-3p	CLIP-seq
MIRT2439518	hsa-miR-193b	CLIP-seq
MIRT2439519	hsa-miR-3120-3p	CLIP-seq
MIRT2392613	hsa-miR-3137	CLIP-seq
MIRT2439520	hsa-miR-3153	CLIP-seq
MIRT2392614	hsa-miR-3158-3p	CLIP-seq
MIRT2439521	hsa-miR-3176	CLIP-seq
MIRT2439522	hsa-miR-3182	CLIP-seq
MIRT2439523	hsa-miR-376a	CLIP-seq
MIRT2439524	hsa-miR-376b	CLIP-seq
MIRT2070432	hsa-miR-377	CLIP-seq
MIRT2439525	hsa-miR-3922-3p	CLIP-seq
MIRT2439526	hsa-miR-3977	CLIP-seq
MIRT2392617	hsa-miR-4446-3p	CLIP-seq
MIRT2439527	hsa-miR-4646-5p	CLIP-seq
MIRT2439528	hsa-miR-4649-3p	CLIP-seq
MIRT2439529	hsa-miR-4668-5p	CLIP-seq
MIRT2070440	hsa-miR-4753-3p	CLIP-seq
MIRT2070441	hsa-miR-4768-5p	CLIP-seq
MIRT1239480	hsa-miR-544b	CLIP-seq
MIRT2439530	hsa-miR-548a-3p	CLIP-seq
MIRT2439531	hsa-miR-548e	CLIP-seq
MIRT2439532	hsa-miR-548f	CLIP-seq
MIRT2439533	hsa-miR-758	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF1	Unknown	12369939
EGR1	Activation	21283769
ETV4	Unknown	11234878
FOS	Unknown	10471035
FOSL1	Unknown	10471035;11234878
FOSL2	Unknown	11234878
FOXP2	Activation	20858596
FOXP2	Unknown	21711233
JUN	Activation	16893520
JUN	Unknown	10471035;11234878;8761947
JUND	Unknown	10471035;11234878
NFKB1	Activation	19020743
NFKB1	Unknown	12244126
RELA	Activation	19020743
RELA	Unknown	12244126
SP1	Activation	14660675
SP1	Unknown	11234878;16261846;17317820
SP3	Unknown	16261846
SPDEF	Repression	12907642
TFAP2A	Unknown	17317820

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	22984561
GO:0005102	Function	Signaling receptor binding	IPI	12665524
GO:0005515	Function	Protein binding	IPI	11290596, 14764453, 15922359, 18376415, 18718938, 24457100, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12665524
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10749881
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006935	Process	Chemotaxis	TAS	10749881
GO:0007165	Process	Signal transduction	TAS	10749881
GO:0007596	Process	Blood coagulation	NAS	8392005
GO:0007596	Process	Blood coagulation	TAS	8049431
GO:0009897	Component	External side of plasma membrane	NAS	1689240
GO:0009986	Component	Cell surface	IDA	15922359
GO:0010755	Process	Regulation of plasminogen activation	NAS	3920216
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	1689240
GO:0019898	Component	Extrinsic component of membrane	TAS	8049431
GO:0019899	Function	Enzyme binding	IPI	14688365, 15922359
GO:0019904	Function	Protein domain specific binding	IPI	12665524
GO:0030155	Process	Regulation of cell adhesion	IDA	10722842
GO:0030162	Process	Regulation of proteolysis	NAS	1689240
GO:0030377	Function	Urokinase plasminogen activator receptor activity	NAS	1689240, 8392005
GO:0034112	Process	Positive regulation of homotypic cell-cell adhesion	IMP	21679692
GO:0035579	Component	Specific granule membrane	TAS
GO:0038023	Function	Signaling receptor activity	NAS	1689240, 8392005
GO:0038023	Function	Signaling receptor activity	TAS	10749881
GO:0038195	Process	Urokinase plasminogen activator signaling pathway	NAS	3920216
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	22984561
GO:0043388	Process	Positive regulation of DNA binding	IDA	22984561
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IMP	22984561
GO:0051917	Process	Regulation of fibrinolysis	NAS	3920216
GO:0070161	Component	Anchoring junction	IEA
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IMP	22984561
GO:0098552	Component	Side of membrane	IEA
GO:0098637	Component	Protein complex involved in cell-matrix adhesion	IPI	24465541
GO:1905370	Component	Serine-type endopeptidase complex	IEA
GO:1905370	Component	Serine-type endopeptidase complex	IPI	22285761
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IMP	22984561

Other IDs

• MIM: 173391
• HGNC: 9053
• e!Ensembl: ENSG00000011422

Protein

• UniProt ID: Q03405
• Protein name: Urokinase plasminogen activator surface receptor (U-PAR) (uPAR) (Monocyte activation antigen Mo3) (CD antigen CD87)
• Protein function: Acts as a receptor for urokinase plasminogen activator (PubMed:15677461). Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-
• PDB: 1YWH, 2FD6, 2I9B, 3BT1, 3BT2, 3U73, 3U74, 4K24, 4QTI, 7E17, 7V63
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00021	UPAR_LY6	25 → 99	u-PAR/Ly-6 domain	Domain
  PF00021	UPAR_LY6	216 → 294	u-PAR/Ly-6 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain.
• Sequence:

  MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
  ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
  GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
  FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
  MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
  QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT

• Sequence length: 335

Pathways

KEGG:

Complement and coagulation cascades
Proteoglycans in cancer

Reactome:

Attachment of GPI anchor to uPAR
Neutrophil degranulation
Dissolution of Fibrin Clot

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLAUR-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	12124797		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	20199127		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29961070		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	36507758	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	15302576		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	29729940	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23998958, 29195018, 30348604		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	8646430, 9215148	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28090093, 9370880	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	8646430	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19638192	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19878584, 22139533, 26869673, 31586488	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25490122, 27624865, 31586488		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12023845, 15381392		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	25196912, 28728756, 35396143, 37810795, 40314383	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32028277	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	19360663	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	19360663		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	19360663, 21328570		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	27986809	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	22261521		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12115506, 27777073		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12115506, 12736046		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	23936839		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10770639, 19404710, 23180655, 23400595		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10766865, 11021826, 11288958, 15226768, 15846059, 16525631, 17079488, 18522728, 19693769, 21106094, 22467324, 23180655, 23747719, 24994498, 25797271, 26631983, 27286449, 28498427, 29382358, 34057113, 36555293, 37661069	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21191179, 9824607	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	15302576		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	19435784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	18519000	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	22052326	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25236186, 34854209	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	15226768	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27777073		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19117638		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31703596	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	19435784, 21999221, 30348604	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34596153, 36360294, 37919459	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35675366	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18519000, 26050228, 27246533	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	25328065		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26408685		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	15302576		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24249636, 34706549, 37079385, 38014560	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27794105		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	27986809	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	36214722	Associate	★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	26718775		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20199127, 7926038		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12865932, 32012858, 9990071	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16912170, 19123477		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17317820, 18511987, 20199127, 9667756		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10447677, 11376560, 12865932, 15004225, 19672256, 22927998, 23300952, 24742002, 25692297, 7926038, 9045899, 9824607	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12405290, 18511987		★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	24731575		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16077991		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal ulcer	Pubtator	23190581	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28980286	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	24934367	Associate	★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	24833530	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28090093		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	15122709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	LHGDN	16858643		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	16858643		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30426662		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30426662		★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Patent ductus arteriosus	Pubtator	19435784	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12130664	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	22606320	Stimulate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26408685		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	15309734	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	21193525	Stimulate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	27862217		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	7495280	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma 3 primary infantile B	Glaucoma	Pubtator	19693769	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10845561, 11234878, 29445239, 30296054		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	11959893, 18819934		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19147534, 25556371, 30894197, 40508119	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10845561, 11234878, 29445239, 30296054		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11234878, 17634529		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11572856, 16465367, 17172424, 17549401, 18813792, 19724922, 21060833, 21964739, 22076676, 23076139, 30894197, 33687124, 40508119	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	24648800	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	23874017, 31188898	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	31191741	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28039488		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	18519000	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28967680, 37140510	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	20872175	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	21711234	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	1325906, 18954937	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	31359505	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30426662		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14660675, 15846059, 21576240	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29966011, 34596153, 34814275, 36214722	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21309737	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	18508599		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	24249636	Associate	★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	25661888		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12423685	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12423685, 15849776, 21711234	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12423685, 26082201		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	15849776		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21125336, 28249642, 31538341		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17427199		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	19638192	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	36555850	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12174885, 12704669, 14507113, 17706320		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17548471, 36124441, 7646466, 9743310	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33134397	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	39224582	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16810742, 24833530, 26516369, 36835265	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28039488		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19404710, 23180655, 23400595		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19117638		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21125336, 28249642, 31538341		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19484141, 28529645		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15302576		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17658220, 21047537, 21308698		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	28039488		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27777073		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12423685, 16008557, 23066953, 28340565, 28869084, 29445239, 29484286, 29546835		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	22261521		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17001307, 20199127, 7926038		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14601049, 15543615, 17952591		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	21148633	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12376466, 14729600		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	14660675, 29216889, 30611716, 30640942, 32012858, 33972390, 34315564	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	16685436, 28442916		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	16685436, 18949356		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	21426933, 23222509	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	19435784	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10929035, 12648064, 21711234, 28340565	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28340565		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	8556526	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	11687463	Stimulate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	11204271	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	12393744		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	12393744	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	20518747		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11517932, 12796395, 15319566, 16361535, 16617013, 17297470, 18511987, 19732125, 21735101, 22213823, 24396518, 25652012, 27151939, 28039488, 28529645, 28679779, 29075357, 9482108, 9667756, 9681686		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	22261521		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	17634529		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31990070	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29961070, 29966011		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21372607, 38014560	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	9215148	Associate	★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	18487955	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10086509, 16008557	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16008557		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	14563447		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10417342, 12571229, 15798771, 31387176, 9821967	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19484141, 28529645		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16504015, 18953252		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	19484141		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16504015, 21263190, 25170871, 25215932, 25268648, 27130234, 30805627, 9020484, 9665481	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	9482108		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	1325906		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	8879451	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	9347794	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	28728756	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	18029284		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	10753836		★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	BEFREE	20858596		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17658220, 21047537, 21308698		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	LHGDN	16949925		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15302576		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15928670, 16756681, 17509140, 18097558, 19330806, 20976141, 21047537, 21824975, 24681666, 25544710, 31186527	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16127174, 16949925, 18097558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20967855	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19638192	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20075389, 23806081	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23852693		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16077991		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	16077991		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31555383		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28090093		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	LHGDN	17523079		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	20051950, 21702998	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	39940697	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	23852693		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	20967855	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	20967855, 25569146	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	29670612	Stimulate	★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	31191741	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	20403162	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	19029002, 31555383		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	25414274	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	19117638, 23066953		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	17327908, 26050228	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	36643579	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17880283, 18673553		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25328065		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18673553, 24999729, 28841839, 30231175, 33892811, 35775375, 36425786, 36835265, 39511134, 39744227	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15929171, 16435385, 16810742, 19050704, 28627240, 28643742, 35864968, 8703368	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18247343, 19020743, 19050704		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	20967855, 23852693		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	15375521		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	20403162	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	18954937	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21191179, 28039715	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	40157360	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25652012, 31777866		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27286449, 27502396	Associate	★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	15302576		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15816639, 26292086	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24833530, 32488496	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	25196912	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	19552680	Inhibit	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	19552680	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	19878584	Associate	★☆☆☆☆ Found in Text Mining only