PLAU (plasminogen activator, urokinase)

Gene

• Entrez ID: 5328
• Gene name: Plasminogen activator, urokinase
• Gene symbol: PLAU
• Synonyms (NCBI Gene): ATF, BDPLT5, QPD, UPA, URK, u-PA
• Chromosome: 10
• Chromosome location: 10q22.2
• Summary: This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004291	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot	19490101
MIRT004291	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot	19490101
MIRT004413	hsa-miR-193b-3p	Western blot, Luciferase reporter assay	19701247
MIRT004291	hsa-miR-23b-3p	qRT-PCR, Western blot	21242962
MIRT024290	hsa-miR-215-5p	Microarray	19074876
MIRT026220	hsa-miR-192-5p	Microarray	19074876
MIRT004413	hsa-miR-193b-3p	Microarray, qRT-PCR, Western blot	23372348
MIRT127249	hsa-miR-193a-3p	HITS-CLIP	22473208
MIRT004413	hsa-miR-193b-3p	HITS-CLIP	22473208
MIRT127203	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT127204	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT127249	hsa-miR-193a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27307030
MIRT127249	hsa-miR-193a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27307030
MIRT1556808	hsa-miR-455-3p	CLIP-seq
MIRT2070422	hsa-miR-181a	CLIP-seq
MIRT2070423	hsa-miR-181b	CLIP-seq
MIRT2070424	hsa-miR-181c	CLIP-seq
MIRT2070425	hsa-miR-181d	CLIP-seq
MIRT2070426	hsa-miR-4262	CLIP-seq
MIRT2392609	hsa-miR-4690-3p	CLIP-seq
MIRT2392610	hsa-miR-4731-3p	CLIP-seq
MIRT2392611	hsa-miR-4801	CLIP-seq
MIRT2392612	hsa-miR-595	CLIP-seq
MIRT2595043	hsa-miR-1233	CLIP-seq
MIRT2595044	hsa-miR-146b-3p	CLIP-seq
MIRT2070422	hsa-miR-181a	CLIP-seq
MIRT2070423	hsa-miR-181b	CLIP-seq
MIRT2070424	hsa-miR-181c	CLIP-seq
MIRT2070425	hsa-miR-181d	CLIP-seq
MIRT2595045	hsa-miR-3074-3p	CLIP-seq
MIRT2595046	hsa-miR-3173-5p	CLIP-seq
MIRT2595047	hsa-miR-3591-5p	CLIP-seq
MIRT2595048	hsa-miR-361-5p	CLIP-seq
MIRT2070426	hsa-miR-4262	CLIP-seq
MIRT2595049	hsa-miR-490-5p	CLIP-seq
MIRT2595050	hsa-miR-593	CLIP-seq
MIRT2595051	hsa-miR-767-3p	CLIP-seq
MIRT2595052	hsa-miR-874	CLIP-seq
MIRT2688006	hsa-miR-1200	CLIP-seq
MIRT2595043	hsa-miR-1233	CLIP-seq
MIRT2688007	hsa-miR-1275	CLIP-seq
MIRT2595044	hsa-miR-146b-3p	CLIP-seq
MIRT2070422	hsa-miR-181a	CLIP-seq
MIRT2070423	hsa-miR-181b	CLIP-seq
MIRT2070424	hsa-miR-181c	CLIP-seq
MIRT2070425	hsa-miR-181d	CLIP-seq
MIRT2688008	hsa-miR-192	CLIP-seq
MIRT2688009	hsa-miR-19a	CLIP-seq
MIRT2688010	hsa-miR-19b	CLIP-seq
MIRT2688011	hsa-miR-215	CLIP-seq
MIRT2595045	hsa-miR-3074-3p	CLIP-seq
MIRT2688012	hsa-miR-3074-5p	CLIP-seq
MIRT2688013	hsa-miR-3144-5p	CLIP-seq
MIRT2688014	hsa-miR-3150a-5p	CLIP-seq
MIRT2688015	hsa-miR-3150b-5p	CLIP-seq
MIRT2595046	hsa-miR-3173-5p	CLIP-seq
MIRT2688016	hsa-miR-329	CLIP-seq
MIRT2595048	hsa-miR-361-5p	CLIP-seq
MIRT2688017	hsa-miR-362-3p	CLIP-seq
MIRT2688018	hsa-miR-3925-3p	CLIP-seq
MIRT2688019	hsa-miR-3941	CLIP-seq
MIRT2070426	hsa-miR-4262	CLIP-seq
MIRT2688020	hsa-miR-4433	CLIP-seq
MIRT2688021	hsa-miR-4447	CLIP-seq
MIRT2688022	hsa-miR-4472	CLIP-seq
MIRT2688023	hsa-miR-4525	CLIP-seq
MIRT2688024	hsa-miR-4665-5p	CLIP-seq
MIRT2392609	hsa-miR-4690-3p	CLIP-seq
MIRT2688025	hsa-miR-4723-5p	CLIP-seq
MIRT2392610	hsa-miR-4731-3p	CLIP-seq
MIRT2688026	hsa-miR-4789-3p	CLIP-seq
MIRT2392611	hsa-miR-4801	CLIP-seq
MIRT2595049	hsa-miR-490-5p	CLIP-seq
MIRT2392612	hsa-miR-595	CLIP-seq
MIRT2688027	hsa-miR-603	CLIP-seq
MIRT2688028	hsa-miR-625	CLIP-seq
MIRT2688029	hsa-miR-648	CLIP-seq
MIRT2688030	hsa-miR-665	CLIP-seq
MIRT2688031	hsa-miR-711	CLIP-seq
MIRT2688032	hsa-miR-766	CLIP-seq
MIRT2595052	hsa-miR-874	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF2	Unknown	10454570
ATF4	Activation	18829529
CREB1	Unknown	11776974
EGR1	Activation	21283769
ETS1	Unknown	10211993;11556732
FOS	Unknown	11774399
GATA6	Repression	15231498
HIF1A	Unknown	14567996
HOXD3	Unknown	14610084
ILF3	Activation	22986534
JUN	Unknown	10454570;11774399
NFKB1	Activation	11689575;17407600;20352621
POU2F1	Unknown	10951201
RARA	Unknown	10361124
RELA	Activation	11689575;17407600;20352621
RFWD2	Repression	12615916
RUNX2	Unknown	18331818
SP1	Unknown	10361124
SRF	Activation	15514113

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	3501295, 7904248, 10340997, 14696115, 18376415, 22449964, 25168896, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18835034, 24434139
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	6589620
GO:0006935	Process	Chemotaxis	TAS	10749881
GO:0007165	Process	Signal transduction	TAS	10749881
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	8663461, 12435727, 24854121
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IMP	8253073
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0009897	Component	External side of plasma membrane	NAS	1689240
GO:0009986	Component	Cell surface	IDA	18835034
GO:0010755	Process	Regulation of plasminogen activation	NAS	3920216
GO:0010757	Process	Negative regulation of plasminogen activation	NAS	8508955
GO:0014909	Process	Smooth muscle cell migration	IEA
GO:0014910	Process	Regulation of smooth muscle cell migration	IDA	8837777
GO:0016787	Function	Hydrolase activity	IEA
GO:0030155	Process	Regulation of cell adhesion	IDA	10722842
GO:0030335	Process	Positive regulation of cell migration	IDA	25168896
GO:0031639	Process	Plasminogen activation	IBA
GO:0031639	Process	Plasminogen activation	IDA	25978044
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IBA
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IDA	8837777
GO:0035579	Component	Specific granule membrane	TAS
GO:0038195	Process	Urokinase plasminogen activator signaling pathway	NAS	3920216
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042730	Process	Fibrinolysis	IBA
GO:0042730	Process	Fibrinolysis	IEA
GO:0042730	Process	Fibrinolysis	IEA
GO:0042730	Process	Fibrinolysis	TAS
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IDA	30241478
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IDA	30241478
GO:0048018	Function	Receptor ligand activity	IDA	30241478
GO:0051917	Process	Regulation of fibrinolysis	NAS	3920216
GO:0051918	Process	Negative regulation of fibrinolysis	NAS	8508955
GO:0061041	Process	Regulation of wound healing	IC	8837777
GO:0061041	Process	Regulation of wound healing	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0097180	Component	Serine protease inhibitor complex	IPI	21199867
GO:0098637	Component	Protein complex involved in cell-matrix adhesion	IPI	24465541
GO:1905370	Component	Serine-type endopeptidase complex	IEA
GO:1905370	Component	Serine-type endopeptidase complex	IPI	22285761
GO:2000097	Process	Regulation of smooth muscle cell-matrix adhesion	IDA	8837777
GO:2001044	Process	Regulation of integrin-mediated signaling pathway	IDA	8837777

Other IDs

• MIM: 191840
• HGNC: 9052
• e!Ensembl: ENSG00000122861

Protein

• UniProt ID: P00749
• Protein name: Urokinase-type plasminogen activator (U-plasminogen activator) (uPA) (EC 3.4.21.73) [Cleaved into: Urokinase-type plasminogen activator long chain A; Urokinase-type plasminogen activator short chain A; Urokinase-type plasminogen activator chain B]
• Protein function: Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
• PDB: 1C5W, 1C5X, 1C5Y, 1C5Z, 1EJN, 1F5K, 1F5L, 1F92, 1FV9, 1GI7, 1GI8, 1GI9, 1GJ7, 1GJ8, 1GJ9, 1GJA, 1GJB, 1GJC, 1GJD, 1KDU, 1LMW, 1O3P, 1O5A, 1O5B, 1O5C, 1OWD, 1OWE, 1OWH, 1OWI, 1OWJ, 1OWK, 1SC8, 1SQA, 1SQO, 1SQT, 1U6Q, 1URK, 1VJ9, 1VJA, 1W0Z, 1W10, 1W11, 1W12, 1W13, 1W14, 2FD6, 2I9A, 2I9B, 2NWN, 2O8T, 2O8U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00051	Kringle	70 → 151	Kringle domain	Domain
  PF00089	Trypsin	179 → 419	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the prostate gland and prostate cancers. {ECO:0000269|PubMed:15988036}.
• Sequence:

  MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
  HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
  YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
  GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
  RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
  PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
  CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
  SHTKEENGLAL

• Sequence length: 431

Pathways

KEGG:

NF-kappa B signaling pathway
Complement and coagulation cascades
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Prostate cancer

Reactome:

Neutrophil degranulation
Dissolution of Fibrin Clot

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer disease type 1	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE, FAMILIAL, 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer disease, late-onset, susceptibility to	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGINA PECTORIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGINA, UNSTABLE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANURIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIAL OCCLUSIVE DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHENOZOOSPERMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTEROL EMBOLISM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPYEMA, PLEURAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART RUPTURE, POST-INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMATURIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HENOCH-SCHOENLEIN PURPURA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung disease, susceptibility to, 1	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL EMBOLISM AND THROMBOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL HEMORRHAGES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITRAL VALVE PROLAPSE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLAU-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Quebec platelet disorder	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SAGITTAL SINUS THROMBOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOEMBOLISM	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR FIBRILLATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	12742636		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	10467400		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15515049, 18376309, 1850957, 19435784, 21670079, 30568465, 7664291, 7750207		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15515049, 18376307		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	1648983		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10467400, 15683429		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	10467400		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	10467400		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	10467400		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	9006343		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	9006343		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22511755, 24623737		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11160720		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30518218		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18076107	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	12898287, 15615772, 18076107		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	36507758	Inhibit	★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	10844794, 10914816, 11776074, 8033079		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	17406368		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	CTD_human_DG	2382605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angioedemas Hereditary	Angioedema	Pubtator	11050091	Inhibit	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	18376307, 30173393		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	35952493	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	35952493, 7552526, 7615837, 9013920	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	24452721, 9013920		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	9013920	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	37175670	Associate	★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	19153874		★☆☆☆☆ Found in Text Mining only
Arterial Diseases, Common Carotid	Moyamoya disease	CTD_human_DG	10512912		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	CTD_human_DG	15557913, 1713745, 9181759, 9731615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	9013920	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	21536666, 7615162, 9186598		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	19298527, 8646430	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29282305		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19298527	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	8646430, 9370880	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	CTD_human_DG	18998460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	16236890, 16728704, 17363771		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	16728704, 24111848	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	17363771, 19098125		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	21912604		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	11814314, 8033079		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	11939722, 19775294, 7604873	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15231498		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15231498	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21536666, 7615162, 9186598		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35795669	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	15375521		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21965736		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10599442, 29945448		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12115506, 12736046, 17921261		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	8879451	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	11435291, 15026313, 20007542, 21495923		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	39729750	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders Inherited	Blood coagulation disorder	Pubtator	19029443	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	28301587, 32761872	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	CTD_human_DG	16475674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone neoplasms	Bone neoplasms	BEFREE	18472961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Embolism and Thrombosis	Embolism and Thrombosis	CTD_human_DG	9403446		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	10472989, 10512912, 17927297, 9731615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	11489835, 15047912, 17233842, 28442916, 9989951		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	20924077, 9862567	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10642432, 10766865, 11245436, 11288958, 11489825, 12023852, 12142386, 12198113, 12574821, 12581744, 14704150, 15131040, 15150277, 15543615, 15867352, 16172791, 16380248, 16525628, 16685447, 16963728, 18204793, 18266970, 19082473, 19354275, 19475533, 19701247, 20498646, 21199807, 22445926, 22617030, 22986534, 23201006, 2440556, 25377085, 26040548, 27609788, 28560500, 29107218, 29340066, 30646864, 30707839, 30783124, 31317530, 7695959, 9496254, 9542512, 9681686		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	30562887	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10389993, 10402467, 10766865, 11021826, 11288958, 11606583, 11689575, 11805108, 12198113, 12377770, 12477728, 12556966, 12771144, 12819009, 14704150, 15846059, 16439808, 16525631, 17257442, 17696882, 18579687, 18922176, 19153192, 19693769, 19845941, 20204407, 20926736, 21897119, 22467324, 22736175, 25200076, 25377085, 25728938, 26805406, 27307030, 28209486, 28634007, 28877230, 28954632, 29382358, 30170623, 30646864, 31142059, 31317530, 31359505, 32115494, 36323529, 7604873, 8394731, 8641985, 9083329, 9635833, 9679732	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19826838, 30562887, 34641959	Stimulate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	29453410	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26033187, 34358255	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11231307, 11454671, 19435784, 21199807, 7485393, 9626349		★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26033187	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10470287, 1330539, 19177205, 19293637, 19490101, 21512310, 22363545, 23035214, 23437203, 23468978, 24330766, 24886639, 26204832, 27092498, 31791275, 33350772, 37884951	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	23724131	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	22296682, 28634007	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	1310252	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	15683429		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10599442, 27609788, 29945448		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10645902, 16170032, 20432172, 7485393, 9766559, 9769949		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19603017	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23864708, 28284058, 31311829, 32464191, 36591282	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18195710, 31217736, 31821170, 34358255	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	7604879	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11231307, 1918364	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	11231307		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	10467400		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	10467400		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	7485393		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15386422, 27345498, 29439245, 9194591		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17331567		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21683250		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	10512912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Atherosclerosis	Carotid Atherosclerosis	CTD_human_DG	10512912		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	18813852		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	27986809	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	15894933		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms, Primary	Central Nervous System Neoplasms	BEFREE	15894933		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	12754271	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Embolism and Thrombosis	Cerebral Embolism And Thrombosis	CTD_human_DG	9403446		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	12754271	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	CTD_human_DG	12133459, 15502123, 16773802		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	BEFREE	30539695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	36214722	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	12742636		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	31356182		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular Disorders	CTD_human_DG	1265806, 17308290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Insufficiency	Cerebrovascular Insufficiency	CTD_human_DG	1265806, 17308290		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Occlusion	Cerebrovascular Occlusion	CTD_human_DG	1265806, 17308290		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21242962, 24474395, 28118037		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	21242962, 24474395, 28118037		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21972289		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22511755, 24623737		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22294827, 24935374	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28667127		★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Cholesterol Embolism	Atheromatous embolus	CTD_human_DG	16773802		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	Pubtator	11777908, 23661254	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	12180971, 12402308		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	LHGDN	17949787		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30124995		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29058166, 30124995, 31567954		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	16236890		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25706093, 30820636		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	16958060		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	9546434		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	22911757	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31758376		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36854781	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11291054, 15004225, 16912170, 1855221, 20931209, 23553997, 25113506, 26040548, 27717848, 31758376, 7664291, 7737909, 7750207		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18237545, 19123477		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20931209	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Adenomatous Polyposis Autosomal Recessive	Colorectal adenomatous polyposis	Pubtator	9006343	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11876553, 12405290, 12430175, 18511987, 18616803, 19740518, 22819556, 23300952, 24742002, 25962429, 29107070, 30885929, 31354344		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12218297, 16916471, 17804466, 18076013, 19436306, 22927998, 25536597, 36854781, 7737909	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12430175, 15849510, 17203175, 18076013		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	22927998, 24742002		★☆☆☆☆ Found in Text Mining only
Communicating Hydrocephalus	Communicating Hydrocephalus	BEFREE	27614013		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	24935374		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31659734, 31741050		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16077991, 16289236, 7604879		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal ulcer	Pubtator	23190581	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24952395		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24952395		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24952395, 35795669	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	CTD_human_DG	1730212, 9181759		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	24952395		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASCAT_DG	26192919, 26974007, 28067908		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	16236890		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19399182	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	CTD_human_DG	15557913, 3161212, 3488869, 6359570		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	15067375		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	29107070, 31758376		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	34828412	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	22152193		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	10954203	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	LHGDN	16858643		★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	27206134	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	8980278	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	16858643		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	20617897	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15750768		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29464181		★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	30937621, 9006343	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	29137300		★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Patent ductus arteriosus	Pubtator	19435784	Associate	★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	26033187		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11063652, 21761413, 26033187, 9009232		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	26033187		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26033187, 34712201	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12832381, 14644829, 16855359		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	14644829, 21819230		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32909189	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	33249961	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28722103		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27345498		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	7606888		★☆☆☆☆ Found in Text Mining only
Erythrokeratoderma	Erythrokeratoderma	BEFREE	20854438		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30568465		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	18570153		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30568465		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36588538	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10666386, 30817615, 33374641, 34404882	Associate	★☆☆☆☆ Found in Text Mining only
External Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	10512912		★☆☆☆☆ Found in Text Mining only
Factor V Deficiency	Factor v deficiency	Pubtator	32761872	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Familial Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	18491991		★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	BEFREE	7579461		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	12115573, 3780677, 9743289		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	16958060, 26877613		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	18481824, 26396155		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	26846181		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	34828412	Associate	★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	BEFREE	19153874		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	14714609		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	30988500	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	7495280	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma 3 primary infantile B	Glaucoma	Pubtator	19693769	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10844794, 10853019, 10914816, 11115541, 11234878, 11489835, 11688967, 11776074, 12420219, 12545160, 15047912, 17273768, 18819934, 20467333, 20606645, 21896743, 28316028, 7747809, 8033079, 9219733		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17974965, 18355442		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18819934, 19147534, 25556371, 32065471, 34899682	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32060379	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11115541, 11489835, 11688967, 12420219, 12545160, 15047912, 17273768, 18819934, 20606645, 21896743, 28316028, 7747809, 8033079, 9219733		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10416596, 11115541, 11489835, 11776074, 11791179, 12241114, 12955075, 30507090, 9219733		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12764090		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17549401, 19383369, 20511184, 7604873	Associate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	20606645		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	24648800	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	27127888	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	24822208	Associate	★☆☆☆☆ Found in Text Mining only
Hamman-Rich Disease	Diffuse interstitial pulmonary fibrosis	CTD_human_DG	18491991		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24705283		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24705283, 36510962	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31741050		★☆☆☆☆ Found in Text Mining only
Heart Rupture, Post-Infarction	Myocardial rupture	CTD_human_DG	9403446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangioblastoma	Hemangioblastoma	BEFREE	10485495		★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	9083329	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	1325906	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria, Paroxysmal	Paroxysmal Hemoglobinuria	LHGDN	12041678		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	8084301	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	15026313, 20007542	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	CTD_human_DG	12671112, 9002298		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	31359505	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18239069, 27782108, 30562887	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11091852		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	39329718	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31454257		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30905258		★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	BEFREE	7579461		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11023511	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14534291, 15846059, 16309542, 36591282	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14699120, 16123583, 20491781, 25122487, 34691034, 36214722, 37277450, 39351249	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	24822208		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	18491991, 28273432		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18491991		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	18491991		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28139758	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	9002298		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11283864, 15331414, 18297057, 18697217, 20677288		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	11677890, 15181847, 17702958		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233		★☆☆☆☆ Found in Text Mining only
Internal Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	10512912		★☆☆☆☆ Found in Text Mining only
Intracranial Embolism and Thrombosis	Intracranial Embolism And Thrombosis	CTD_human_DG	9403446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	9006343		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	10849091		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24649947, 29890880		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29909410		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	15944400		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	24822208	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30124995		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	8883400	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	17523079		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28693180, 7841298		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33146708	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16102112, 33284559	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	8142655	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15849776		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	18486529, 28841839		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	23661254	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10925356, 12536199, 1330539, 15210852, 17159381, 19177205, 19490101, 21465475, 21512310, 24330766, 24886639, 26916922, 28922551, 30376856, 9096588		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15210852, 15217951		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16958060		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	18481824, 26396155		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	31791275	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	BEFREE	15331414, 20174638		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	1330539		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	31067569, 9137088	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12114193, 1310252, 18390474, 19937138, 21398193, 23563849, 30477473, 7485393, 9137088, 9743310	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14507113		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	15514113, 28972182		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10666386, 16810742, 26033187, 32464191, 34854950, 8883400	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12556966, 28454121, 37960806, 7737909, 9137088	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	15490235		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	7548228	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	22152193, 27219347		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	CTD_human_DG	16475674		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	17523079		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10853019		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	24705283		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	27602956		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	20606645		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10642432, 10766865, 11245436, 11288958, 11489825, 12023852, 12142386, 12198113, 12574821, 14704150, 15131040, 15150277, 15543615, 15867352, 16172791, 16380248, 16525628, 16685447, 16963728, 18204793, 19082473, 19354275, 19475533, 19701247, 20498646, 21199807, 22445926, 22617030, 22986534, 23201006, 25377085, 26040548, 27609788, 28560500, 29107218, 29340066, 30646864, 30707839, 30783124, 31317530, 7695959, 8641985, 9496254, 9681686		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21761413, 9009232		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30568465		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19177204, 25174715		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10645902, 16170032, 20432172, 7485393, 9766559, 9769949		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	18486529, 28841839		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15386422, 29439245, 9194591		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	10467400		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15257104, 15683429, 18953252, 19435784, 19484141, 25215905, 31297881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10465276, 11454671, 11676474, 11745419, 12004003, 12773490, 15023541, 16305345, 16430655, 17409440, 18225541, 18472961, 19001380, 21308698, 21965736, 22293856, 22797919, 23541763, 27609788, 30707839, 31797075, 7479394, 9751264, 9766566		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	11454671, 16430655, 17192053		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12708473, 15929171, 23985164, 27352182, 29344165, 8624578, 8625219, 9794194		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10599442, 27609788, 29945448		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10218628, 11029504, 11223863, 11231307, 11454671, 11489825, 11489835, 11920633, 12023852, 12168869, 12198113, 12430175, 12536199, 14595671, 15004225, 15168733, 15683429, 15920519, 16109653, 16170032, 16305345, 16475943, 17075310, 18095109, 1855221, 18958175, 19037241, 19208845, 19354275, 19391133, 19490101, 19527776, 21080821, 21199807, 21606492, 21702998, 21829465, 21833477, 22213823, 22445926, 23038812, 23201006, 23661500, 24742002, 24822208, 25200076, 25672980, 25865774, 26050228, 26718643, 26851004, 27176787, 28498893, 28722327, 28820062, 29086689, 29107218, 29307852, 29344165, 29484286, 29500719, 30231175, 31176112, 31679971, 31830149, 7664291, 7695959, 7737909, 8703368, 8968087, 9219733, 9496254, 9626349, 9681686, 9766559, 9766566, 9818827		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21242962, 24474395, 28118037		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11291054, 15004225, 16912170, 1855221, 23553997, 25113506, 26040548, 27717848, 31758376, 7664291, 7737909, 7750207		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12477728, 12743986, 14704150, 14983219, 14983227, 15646834, 16685447, 17258797, 17657740		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15867352, 16172791, 18204793, 19701247, 22842551, 22986534, 27176787		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22511755, 24623737		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12684636		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15054877, 1918136, 8291613		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23063511	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	2501786, 8291613, 9837898	Associate	★☆☆☆☆ Found in Text Mining only
Meleda Disease	Meleda Disease	BEFREE	20854438		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	16685436, 18949356		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	18095114, 20862517, 23441133, 28442916		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	23222509, 23441133	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	22152193		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	2555056		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	28278500		★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	11677890, 15181847, 17702958		★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	15262029		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	LHGDN	15262029		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth Neoplasms	LHGDN	15356878		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36510962	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10929035, 17593251, 18812315, 28340565	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	11204271	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	11204271, 24469912		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	1908371, 2174952, 2382605, 3068399, 3984876, 8416330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	20518747		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyposis	BEFREE	30605632		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	38050231	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10209960, 10218628, 10408848, 10416596, 10485495, 10599442, 10666386, 10741738, 10815897, 10844794, 10914816, 11018722, 11278833, 11454671, 11559535, 11751384, 11774399, 11776074, 11791179, 12142386, 12536199, 12796395, 12907642, 12955075, 1327511, 14597629, 15047912, 15257104, 15302576, 15350365, 15375521, 15448007, 15490235, 15520187, 15683429, 15781654, 15929171, 16077991, 16430655, 16912170, 16963728, 16982764, 17701256, 18095109, 18204793, 18376309, 18472961, 1855221, 19082473, 19177204, 19208845, 19435784, 19475533, 19490101, 20581861, 20663323, 20696135, 20840675, 20931209, 21683250, 22354580, 22918226, 23038812, 23734810, 23985164, 24742002, 25003596, 25215905, 25798837, 25994573, 26040548, 27345498, 27352182, 28442916, 28526008, 28820062, 28839232, 28841839, 29344165, 29725473, 30225958, 30568465, 30646864, 30817615, 31758376, 7479032, 7604879, 7606888, 8033079, 8181859, 8625219, 8772229, 8861840, 9137088, 9219733, 9310258, 9626349, 9681686, 9766566, 9815623, 9914486		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	BEFREE	10485495		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	CTD_human_DG	12671112		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19276367, 20232396, 23457587, 31176112, 9766559		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	10849091, 17701256, 19082473, 28634007		★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	11774399		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31454257		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	23597113	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	LHGDN	17299841		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10086509	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10807968, 26317203		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15386422, 29439245, 9194591		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15653692, 17187779, 17611702		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10417342, 12496270, 12743121, 14676209, 16002410, 17070899, 17724468, 18461672, 20645833, 20924077, 26992227, 29439245, 39972314, 7479032, 9821967, 9914486	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	21308698		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15257104, 15683429, 18953252, 19435784, 19484141, 25215905, 31297881		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	18376307, 21389187		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	10467400		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	15683429, 19484141		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16504015, 17545513		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14679213, 16547153, 19435784, 22393285, 23864708, 32464191, 34854950, 36061357, 37277450, 9020484, 9665481	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25085839, 26708423		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	15149885		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	1325906		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	8879451	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	12930304		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	17559626		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29752756		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	12743121, 23985164	Associate	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10465276, 11454671, 11676474, 11745419, 12004003, 12773490, 15023541, 15302576, 16305345, 16430655, 17409440, 18225541, 18472961, 19001380, 21308698, 21965736, 22293856, 22797919, 23541763, 27609788, 31797075, 7479394, 9751264, 9766566		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic disease	Pubtator	39390078	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	15342375		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	LHGDN	16949925		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11256475, 12004003, 12841683, 12841684, 15023541, 16207477, 17283123, 17303120, 18097558, 18225541, 19001380, 19147749, 21824975, 22797919, 24877154, 28278500	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	11454671, 16430655, 17192053		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12773490, 12926141, 15886816, 16127174, 16949925, 17192053		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pterygium	Pterygium	BEFREE	10892857, 23322578		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20075389	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25706093	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11000099, 15308506, 22140072, 23852693		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	11000099	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Thromboembolisms	Pulmonary thromboembolism	CTD_human_DG	1098216, 11041470, 4430106, 4884574, 9038699, 9266785		★☆☆☆☆ Found in Text Mining only
Quebec platelet disorder	Quebec Platelet Disorder	BEFREE	11435291, 15026313, 19029443, 20007542, 21495923, 28301587, 31427261		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Quebec platelet disorder	Quebec Platelet Disorder	GENOMICS_ENGLAND_DG	20007542		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Quebec platelet disorder	Quebec Platelet Disorder	ORPHANET_DG	20007542		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Quebec platelet disorder	Quebec Platelet Disorder	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Quebec platelet disorder	Quebec Platelet Disorder	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rectal Prolapse	Rectal Prolapse	BEFREE	11760891		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	6386832		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10485495, 16077991, 16289236, 6386832, 7604879		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	16077991		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	25354239		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28666875		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31251468		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	7702750		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12942549		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	2138329	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10943860, 15998634, 29282305, 29859810		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15083890		★☆☆☆☆ Found in Text Mining only
Ruptured Appendicitis	Appendicitis	BEFREE	19153874		★☆☆☆☆ Found in Text Mining only
Sagittal Sinus Thrombophlebitis	Sagittal Sinus Thrombophlebitis	CTD_human_DG	10668740		★☆☆☆☆ Found in Text Mining only
Sagittal Sinus Thrombosis	Sagittal Sinus Thrombosis	CTD_human_DG	10668740		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	17523079, 23734810		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	LHGDN	17523079		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	17523079, 20051950, 21702998, 23900236	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	23852693, 29760157		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	20943061, 29760157	Stimulate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	20403162		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	20403162	Stimulate	★☆☆☆☆ Found in Text Mining only
Septic Phlebitis, Sagittal Sinus	Septic Phlebitis, Sagittal Sinus	CTD_human_DG	10668740		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	24668673, 24668717, 28273432		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	17006908, 19041311, 24835118, 28253324		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	8394731	Stimulate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	26050228		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11231307, 12384986, 15521066, 19391133, 21833477, 25328065, 30231175, 7861005, 9815623		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17203182, 17880283		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10666386, 30568465, 30817615, 9815623		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	11820719, 18254958, 19835631, 22443116, 22918226, 23621237, 30231175, 30589034, 30937621, 31562292, 33232279, 33420101, 33896830, 35426219, 36266384, 36425786, 36510962, 37960806, 38025757, 39511134, 8883400	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	26050228		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	8386710		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23898067		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	23621237		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12708473, 15929171, 23985164, 27352182, 29344165, 8624578, 8625219, 9794194		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12708473, 15929171, 16367923, 16435385, 16810742, 19294533, 19497102, 20491781, 21734448, 23985164, 28627240, 28643742, 33542925, 34696681, 8703368	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18466392		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	31356182	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subcortical Infarction	Brain Infarction	CTD_human_DG	12133459, 15502123, 16773802		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	15998634		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17133606, 23852693, 25384965, 29760157, 30709025		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	15375521, 9454902		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	31886233	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	31791275	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	8084301	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16203990	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24667444	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	17406368, 35409084	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	16807059, 18321763		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	16135921	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35409084	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	12736046		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27286449, 27502396, 30562887, 34326372	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	22152193		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	38000776	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	11256475	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23940799, 29328476	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36524374	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	33249961	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	7891228	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	25384965		★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	10954203	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	CTD_human_DG	9083243		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Remodeling	Ventricular remodeling	Pubtator	32701210	Stimulate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	10485495		★☆☆☆☆ Found in Text Mining only