Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5327
Gene name	Plasminogen activator, tissue type
Gene symbol	PLAT
Synonyms (NCBI Gene)	T-PATPA
Chromosome	8
Chromosome location	8p11.21
Summary	This gene encodes tissue-type plasminogen activator, a secreted serine protease that converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. The encoded preproprotein is proteolytically processed by plasmin or trypsin to generate heavy and l

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs114878147	G>A	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant

198

Show/Hide all (198)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005838	hsa-miR-204-5p	Microarray	21282569
MIRT005953	hsa-miR-21-5p	Luciferase reporter assayMicroarrayqRT-PCR	21131358
MIRT017829	hsa-miR-335-5p	Microarray	18185580
MIRT735970	hsa-miR-142-5p	MicroarrayqRT-PCR	31552107
MIRT1239429	hsa-miR-1178	CLIP-seq
MIRT1239430	hsa-miR-1237	CLIP-seq
MIRT1239431	hsa-miR-1324	CLIP-seq
MIRT1239432	hsa-miR-186	CLIP-seq
MIRT1239433	hsa-miR-2113	CLIP-seq
MIRT1239434	hsa-miR-3133	CLIP-seq
MIRT1239435	hsa-miR-3182	CLIP-seq
MIRT1239436	hsa-miR-3185	CLIP-seq
MIRT1239437	hsa-miR-320a	CLIP-seq
MIRT1239438	hsa-miR-320b	CLIP-seq
MIRT1239439	hsa-miR-320c	CLIP-seq
MIRT1239440	hsa-miR-320d	CLIP-seq
MIRT1239441	hsa-miR-329	CLIP-seq
MIRT1239442	hsa-miR-340	CLIP-seq
MIRT1239443	hsa-miR-3622b-5p	CLIP-seq
MIRT1239444	hsa-miR-362-3p	CLIP-seq
MIRT1239445	hsa-miR-3941	CLIP-seq
MIRT1239446	hsa-miR-4251	CLIP-seq
MIRT1239447	hsa-miR-4270	CLIP-seq
MIRT1239448	hsa-miR-4303	CLIP-seq
MIRT1239449	hsa-miR-4329	CLIP-seq
MIRT1239450	hsa-miR-4429	CLIP-seq
MIRT1239451	hsa-miR-4441	CLIP-seq
MIRT1239452	hsa-miR-466	CLIP-seq
MIRT1239453	hsa-miR-4672	CLIP-seq
MIRT1239454	hsa-miR-4695-3p	CLIP-seq
MIRT1239455	hsa-miR-4701-5p	CLIP-seq
MIRT1239456	hsa-miR-4711-3p	CLIP-seq
MIRT1239457	hsa-miR-4724-3p	CLIP-seq
MIRT1239458	hsa-miR-542-3p	CLIP-seq
MIRT1239459	hsa-miR-570	CLIP-seq
MIRT1239460	hsa-miR-579	CLIP-seq
MIRT1239461	hsa-miR-588	CLIP-seq
MIRT1239462	hsa-miR-603	CLIP-seq
MIRT1239463	hsa-miR-767-3p	CLIP-seq
MIRT1239442	hsa-miR-340	CLIP-seq
MIRT2432149	hsa-miR-4509	CLIP-seq
MIRT2432150	hsa-miR-4666-3p	CLIP-seq
MIRT2432151	hsa-miR-4744	CLIP-seq
MIRT2432152	hsa-miR-4768-5p	CLIP-seq
MIRT2432153	hsa-miR-561	CLIP-seq
MIRT1239429	hsa-miR-1178	CLIP-seq
MIRT2594990	hsa-miR-1224-5p	CLIP-seq
MIRT1239430	hsa-miR-1237	CLIP-seq
MIRT2594991	hsa-miR-1291	CLIP-seq
MIRT2594992	hsa-miR-1304	CLIP-seq
MIRT2594993	hsa-miR-1587	CLIP-seq
MIRT2594994	hsa-miR-1913	CLIP-seq
MIRT2594995	hsa-miR-193a-5p	CLIP-seq
MIRT2594996	hsa-miR-2110	CLIP-seq
MIRT1239433	hsa-miR-2113	CLIP-seq
MIRT2594997	hsa-miR-3137	CLIP-seq
MIRT2594998	hsa-miR-3140-3p	CLIP-seq
MIRT2594999	hsa-miR-3140-5p	CLIP-seq
MIRT2595000	hsa-miR-3147	CLIP-seq
MIRT2595001	hsa-miR-3153	CLIP-seq
MIRT2595002	hsa-miR-3160-5p	CLIP-seq
MIRT2595003	hsa-miR-3173-5p	CLIP-seq
MIRT2595004	hsa-miR-3189-5p	CLIP-seq
MIRT2595005	hsa-miR-3194-5p	CLIP-seq
MIRT1239437	hsa-miR-320a	CLIP-seq
MIRT1239438	hsa-miR-320b	CLIP-seq
MIRT1239439	hsa-miR-320c	CLIP-seq
MIRT1239440	hsa-miR-320d	CLIP-seq
MIRT2595006	hsa-miR-324-3p	CLIP-seq
MIRT1239441	hsa-miR-329	CLIP-seq
MIRT1239443	hsa-miR-3622b-5p	CLIP-seq
MIRT1239444	hsa-miR-362-3p	CLIP-seq
MIRT2595007	hsa-miR-3691-3p	CLIP-seq
MIRT2595008	hsa-miR-370	CLIP-seq
MIRT2595009	hsa-miR-378g	CLIP-seq
MIRT2595010	hsa-miR-3915	CLIP-seq
MIRT2595011	hsa-miR-3928	CLIP-seq
MIRT1239445	hsa-miR-3941	CLIP-seq
MIRT1239446	hsa-miR-4251	CLIP-seq
MIRT1239447	hsa-miR-4270	CLIP-seq
MIRT2595012	hsa-miR-4271	CLIP-seq
MIRT1239448	hsa-miR-4303	CLIP-seq
MIRT1239449	hsa-miR-4329	CLIP-seq
MIRT2595013	hsa-miR-4428	CLIP-seq
MIRT1239450	hsa-miR-4429	CLIP-seq
MIRT2595014	hsa-miR-4433	CLIP-seq
MIRT2595015	hsa-miR-4434	CLIP-seq
MIRT2595016	hsa-miR-4437	CLIP-seq
MIRT1239451	hsa-miR-4441	CLIP-seq
MIRT2595017	hsa-miR-4459	CLIP-seq
MIRT2595018	hsa-miR-4481	CLIP-seq
MIRT2432149	hsa-miR-4509	CLIP-seq
MIRT2595019	hsa-miR-4516	CLIP-seq
MIRT2595020	hsa-miR-4531	CLIP-seq
MIRT2595021	hsa-miR-4533	CLIP-seq
MIRT2595022	hsa-miR-4640-5p	CLIP-seq
MIRT1239452	hsa-miR-466	CLIP-seq
MIRT2432150	hsa-miR-4666-3p	CLIP-seq
MIRT1239453	hsa-miR-4672	CLIP-seq
MIRT2595023	hsa-miR-4674	CLIP-seq
MIRT2595024	hsa-miR-4689	CLIP-seq
MIRT2595025	hsa-miR-4698	CLIP-seq
MIRT1239455	hsa-miR-4701-5p	CLIP-seq
MIRT1239457	hsa-miR-4724-3p	CLIP-seq
MIRT2595026	hsa-miR-4725-3p	CLIP-seq
MIRT2595027	hsa-miR-4726-5p	CLIP-seq
MIRT2595028	hsa-miR-4731-3p	CLIP-seq
MIRT2595029	hsa-miR-4731-5p	CLIP-seq
MIRT2595030	hsa-miR-4732-5p	CLIP-seq
MIRT2432151	hsa-miR-4744	CLIP-seq
MIRT2595031	hsa-miR-4745-5p	CLIP-seq
MIRT2595032	hsa-miR-4747-5p	CLIP-seq
MIRT2595033	hsa-miR-4758-3p	CLIP-seq
MIRT2595034	hsa-miR-4763-5p	CLIP-seq
MIRT2595035	hsa-miR-4768-3p	CLIP-seq
MIRT2432152	hsa-miR-4768-5p	CLIP-seq
MIRT2595036	hsa-miR-4797-5p	CLIP-seq
MIRT2595037	hsa-miR-4801	CLIP-seq
MIRT2595038	hsa-miR-491-5p	CLIP-seq
MIRT2595039	hsa-miR-516b	CLIP-seq
MIRT2595040	hsa-miR-541	CLIP-seq
MIRT1239458	hsa-miR-542-3p	CLIP-seq
MIRT2432153	hsa-miR-561	CLIP-seq
MIRT1239459	hsa-miR-570	CLIP-seq
MIRT1239460	hsa-miR-579	CLIP-seq
MIRT1239461	hsa-miR-588	CLIP-seq
MIRT2595041	hsa-miR-596	CLIP-seq
MIRT1239462	hsa-miR-603	CLIP-seq
MIRT2595042	hsa-miR-654-5p	CLIP-seq
MIRT1239463	hsa-miR-767-3p	CLIP-seq
MIRT2594990	hsa-miR-1224-5p	CLIP-seq
MIRT1239430	hsa-miR-1237	CLIP-seq
MIRT2594991	hsa-miR-1291	CLIP-seq
MIRT2594992	hsa-miR-1304	CLIP-seq
MIRT2594993	hsa-miR-1587	CLIP-seq
MIRT2594994	hsa-miR-1913	CLIP-seq
MIRT2594995	hsa-miR-193a-5p	CLIP-seq
MIRT2594996	hsa-miR-2110	CLIP-seq
MIRT1239433	hsa-miR-2113	CLIP-seq
MIRT2594997	hsa-miR-3137	CLIP-seq
MIRT2594998	hsa-miR-3140-3p	CLIP-seq
MIRT2594999	hsa-miR-3140-5p	CLIP-seq
MIRT2595000	hsa-miR-3147	CLIP-seq
MIRT2595001	hsa-miR-3153	CLIP-seq
MIRT2595002	hsa-miR-3160-5p	CLIP-seq
MIRT2595003	hsa-miR-3173-5p	CLIP-seq
MIRT2595004	hsa-miR-3189-5p	CLIP-seq
MIRT2595005	hsa-miR-3194-5p	CLIP-seq
MIRT2595006	hsa-miR-324-3p	CLIP-seq
MIRT1239441	hsa-miR-329	CLIP-seq
MIRT1239444	hsa-miR-362-3p	CLIP-seq
MIRT2595007	hsa-miR-3691-3p	CLIP-seq
MIRT2595008	hsa-miR-370	CLIP-seq
MIRT2595009	hsa-miR-378g	CLIP-seq
MIRT2595010	hsa-miR-3915	CLIP-seq
MIRT2595011	hsa-miR-3928	CLIP-seq
MIRT1239445	hsa-miR-3941	CLIP-seq
MIRT1239446	hsa-miR-4251	CLIP-seq
MIRT1239447	hsa-miR-4270	CLIP-seq
MIRT2595012	hsa-miR-4271	CLIP-seq
MIRT1239448	hsa-miR-4303	CLIP-seq
MIRT1239449	hsa-miR-4329	CLIP-seq
MIRT2595013	hsa-miR-4428	CLIP-seq
MIRT2595014	hsa-miR-4433	CLIP-seq
MIRT2595015	hsa-miR-4434	CLIP-seq
MIRT2595016	hsa-miR-4437	CLIP-seq
MIRT1239451	hsa-miR-4441	CLIP-seq
MIRT2595017	hsa-miR-4459	CLIP-seq
MIRT2595018	hsa-miR-4481	CLIP-seq
MIRT2595019	hsa-miR-4516	CLIP-seq
MIRT2595020	hsa-miR-4531	CLIP-seq
MIRT2595021	hsa-miR-4533	CLIP-seq
MIRT2595022	hsa-miR-4640-5p	CLIP-seq
MIRT1239452	hsa-miR-466	CLIP-seq
MIRT1239453	hsa-miR-4672	CLIP-seq
MIRT2595023	hsa-miR-4674	CLIP-seq
MIRT2595024	hsa-miR-4689	CLIP-seq
MIRT2595025	hsa-miR-4698	CLIP-seq
MIRT1239457	hsa-miR-4724-3p	CLIP-seq
MIRT2595026	hsa-miR-4725-3p	CLIP-seq
MIRT2595027	hsa-miR-4726-5p	CLIP-seq
MIRT2595028	hsa-miR-4731-3p	CLIP-seq
MIRT2595029	hsa-miR-4731-5p	CLIP-seq
MIRT2595031	hsa-miR-4745-5p	CLIP-seq
MIRT2595032	hsa-miR-4747-5p	CLIP-seq
MIRT2595033	hsa-miR-4758-3p	CLIP-seq
MIRT2595034	hsa-miR-4763-5p	CLIP-seq
MIRT2595035	hsa-miR-4768-3p	CLIP-seq
MIRT2595036	hsa-miR-4797-5p	CLIP-seq
MIRT2595037	hsa-miR-4801	CLIP-seq
MIRT2595038	hsa-miR-491-5p	CLIP-seq
MIRT2595039	hsa-miR-516b	CLIP-seq
MIRT2595040	hsa-miR-541	CLIP-seq
MIRT1239459	hsa-miR-570	CLIP-seq
MIRT1239460	hsa-miR-579	CLIP-seq
MIRT2595041	hsa-miR-596	CLIP-seq
MIRT1239462	hsa-miR-603	CLIP-seq
MIRT2595042	hsa-miR-654-5p	CLIP-seq

Show/Hide all (9)

Transcription factor	Regulation	Reference
ATF2	Activation	8647095
CREB1	Repression	8647095
CREM	Unknown	9851700
JUN	Activation	1963081
JUN	Unknown	9851700
JUND	Unknown	9851700
NF1	Repression	15044208
SP1	Unknown	21437359;9851700
SP3	Unknown	21437359

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	1695900, 8508955
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005102	Function	Signaling receptor binding	IPI	8186264
GO:0005515	Function	Protein binding	IPI	2503541, 10340997, 12694198, 24196407, 33961781, 39294191
GO:0005515	Function	Protein binding	TAS	8186264
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	1632457
GO:0005737	Component	Cytoplasm	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	3087818
GO:0007596	Process	Blood coagulation	TAS	3839198
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0009986	Component	Cell surface	IDA	1632457
GO:0010757	Process	Negative regulation of plasminogen activation	NAS	8508955
GO:0014909	Process	Smooth muscle cell migration	IBA
GO:0014909	Process	Smooth muscle cell migration	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0031012	Component	Extracellular matrix	IDA	1632457
GO:0031638	Process	Zymogen activation	IEA
GO:0031639	Process	Plasminogen activation	IBA
GO:0031639	Process	Plasminogen activation	IDA	12694198, 17849409, 24196407
GO:0031639	Process	Plasminogen activation	IEA
GO:0036211	Process	Protein modification process	TAS	3087818
GO:0042730	Process	Fibrinolysis	TAS
GO:0045177	Component	Apical part of cell	IEA
GO:0045861	Process	Negative regulation of proteolysis	IDA	1695900
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IBA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0051219	Function	Phosphoprotein binding	IPI	8186264
GO:0051918	Process	Negative regulation of fibrinolysis	NAS	8508955
GO:0060468	Process	Prevention of polyspermy	ISS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0097180	Component	Serine protease inhibitor complex	IPI	26324706
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099183	Process	Trans-synaptic signaling by BDNF, modulating synaptic transmission	IEA

MIM	HGNC	e!Ensembl
173370	9051	ENSG00000104368

P00750

Protein name

Tissue-type plasminogen activator (t-PA) (t-plasminogen activator) (tPA) (EC 3.4.21.68) (Alteplase) (Reteplase) [Cleaved into: Tissue-type plasminogen activator chain A; Tissue-type plasminogen activator chain B]

Protein function

Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migrat

PDB

1A5H , 1BDA , 1PK2 , 1PML , 1RTF , 1TPG , 1TPK , 1TPM , 1TPN , 5BRR , 5ZLZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00039	fn1	41 → 78	Fibronectin type I domain	Domain
PF00008	EGF	86 → 117	EGF-like domain	Domain
PF00051	Kringle	127 → 208	Kringle domain	Domain
PF00051	Kringle	215 → 296	Kringle domain	Domain
PF00089	Trypsin	311 → 556	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Synthesized in numerous tissues (including tumors) and secreted into most extracellular body fluids, such as plasma, uterine fluid, saliva, gingival crevicular fluid, tears, seminal fluid, and milk.

Sequence

MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP

Sequence length

562

Interactions

View interactions

	KEGG		Reactome
	Apelin signaling pathway Complement and coagulation cascades Transcriptional misregulation in cancer Prostate cancer Fluid shear stress and atherosclerosis		Signaling by PDGF Dissolution of Fibrin Clot

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (66)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Abnormal bleeding	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGIOEDEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTIPHOSPHOLIPID SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APHASIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APHASIA, POST ICTAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIAL OCCLUSIVE DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASEPTIC NECROSIS OF HEAD AND/OR NECK OF FEMUR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AVASCULAR NECROSIS OF BONE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN EDEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC TAMPONADE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL THROMBOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTEROL EMBOLISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMISURAL APHASIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPRESSION OF SPINAL CORD	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY THROMBOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEEP VEIN THROMBOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deep venous thrombosis	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEJERINE LICHTHEIM PHENOMENON	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSPHASIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMATOMA, EPIDURAL, SPINAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMATOMA, SUBDURAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOPHILIA A	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary angioedema with normal C1Inh	not provided	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL EMBOLISM AND THROMBOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL HEMORRHAGES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL THROMBOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS OF MEDIAL FEMORAL CONDYLE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARESIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERICARDIAL EFFUSION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLAT-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary embolism	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYNTACTICAL APHASIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytopenia	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
THROMBOEMBOLISM	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOPHILIA, FAMILIAL, DUE TO DECREASED RELEASE OF TISSUE PLASMINOGEN ACTIVATOR	—	ClinGen, Disgenet, GenCC ClinGen, Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASOSPASM, INTRACRANIAL	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VON WILLEBRAND DISEASE, TYPE 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (318)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Activated Protein C Resistance	Activated Protein C Resistance	BEFREE	15609280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	10171637, 10346413, 10436095, 10572812, 11061250, 11108748, 11113218, 11239184, 11739841, 11940547, 12221155, 12230423, 12384244, 12511774, 14581697 View all (43 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	28120326, 28780236, 29171359, 30135678, 31288236, 31394994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	29438080, 29651371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	8356057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	31699117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	6438157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	8058309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16733850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	31106414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	6438157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	15197554, 21339035, 30518218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	26971543, 28550481, 29224744, 29571842, 29705803, 30037650, 30299230, 30488077, 30573458, 30972077, 31436141, 31812956, 31824412, 31836356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	2935973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	LHGDN	14630788, 16320350		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17543671	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	24452721, 7552526, 7615837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	9013920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	9013920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	CTD_human_DG	12690208		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aphasia	Aphasia	BEFREE	28134031		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aphasia, Acquired	Aphasia	CTD_human_DG	12690208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aphasia, Global	Aphasia	CTD_human_DG	12690208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aphasia, Mixed	Aphasia	CTD_human_DG	12690208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aphasia, Progressive	Aphasia	CTD_human_DG	12690208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	12643326	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arterial Occlusive Diseases	Arterial Occlusive Disease	CTD_human_DG	15557913		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	25069814	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	14515193, 15721275, 20051227, 7615162, 9013920, 9186598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16356191, 9370880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	8646430	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	17723126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	1447036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	11864703		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	12677255		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	14515193, 15721275, 20051227, 7615162, 9186598		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	25807501, 8300642	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29373227, 31226920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27957319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	9858820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	28373474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	15008985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	25673638, 29097489, 29196200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	3876929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Embolism and Thrombosis	Embolism and Thrombosis	CTD_human_DG	7482654, 8427107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	CTD_human_DG	16190367		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Infarction	Brain Infarction	BEFREE	31837389		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	10572812, 11108748, 11940547, 12221155, 12511774, 14986460, 15017018, 15087567, 16126134, 16809570, 17086147, 17525387, 17903870, 20123226, 20212195 View all (9 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	30139371		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	34796748	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Thrombosis	Cerebral Thrombosis	CTD_human_DG	8678742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Thrombus	Cerebral Thrombus	CTD_human_DG	8678742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11555606, 11840342, 16277885, 2112958, 21964832, 24220687, 2440556, 24498382, 28765903, 30112019, 30641217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19407555	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25728938, 26339655, 37338518, 37753740, 38237862, 8394731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16044159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15086463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiac Tamponade	Cardiac Tamponade	CTD_human_DG	9633741		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardioembolic stroke	Cardioembolic Stroke	BEFREE	16179568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18953568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21683250, 9193430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Caroli Disease	Caroli Disease	BEFREE	19025978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Embolism and Thrombosis	Cerebral Embolism And Thrombosis	CTD_human_DG	7482654, 8427107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	38103737, 9559429	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	BEFREE	14617754, 14983220, 27352315, 28379489, 29221968, 29263145, 29547062, 29766770, 30539695		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	CTD_human_DG	15502123, 1579960, 16148626, 18544249, 1899364, 9183334		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	15911618, 17723126	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	22178875, 23360689, 30404981, 32568648, 37986378, 38103737	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Thrombosis	Cerebral Thrombosis	CTD_human_DG	8678742		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Thrombus	Cerebral Thrombus	CTD_human_DG	8678742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	CTD_human_DG	19057314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	CTD_human_DG	10171637, 10346413, 10436095, 10572812, 11061250, 11108748, 11113218, 11239184, 11739841, 11940547, 12221155, 12230423, 12384244, 12511774, 14581697 View all (43 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	11385207, 16179568, 17689411, 17689414, 19574439, 19608750, 20216551, 21437359, 22240314, 22425140, 23570848, 27472425, 28089562, 28096207, 28096208 View all (73 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	LHGDN	15846799, 15916851, 16385091		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	34796748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	6438157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28373474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesterol Embolism	Atheromatous embolus	CTD_human_DG	7939511		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Kidney Diseases	Kidney Disease	BEFREE	18508579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	2496772, 6883302, 9858820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	3092643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15006132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	29962211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chylopericardium	Chylopericardium	CTD_human_DG	9633741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30093697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19636513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Adenomatous Polyposis Autosomal Recessive	Colorectal adenomatous polyposis	Pubtator	9006343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22276141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10763140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	CTD_human_DG	12227717		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	27077766, 3876929, 6883302, 8876615, 9858820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19025978		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	22352330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conus Medullaris Syndrome	Conus Medullaris Syndrome	CTD_human_DG	12227717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	27618679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10744143, 11229822, 11507973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21034162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	22235876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16836660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	CTD_human_DG	1452937, 15301905, 8172379		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Thrombosis	Coronary Thrombosis	BEFREE	2453751, 9327764		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Craniosynostosis	Craniosynostosis	BEFREE	29962211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	CTD_human_DG	11144008, 15557913, 19415734		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deep Vein Thrombosis	Thrombosis	BEFREE	29538006, 31129644, 31602245		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	29348904, 31610810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28000518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	17374397		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Allergic Contact	Dermatitis	BEFREE	24245569		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Irritant	Dermatitis	BEFREE	30647816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31751638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28983900, 30051168, 31221695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28983900, 29373227, 29571842, 30051168, 30488077, 31035901, 31221695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31104419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22577291	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23249721	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26420861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31837411		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	LHGDN	17636064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	12643326	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	15055254	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	30647816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	31102491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	12589088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	17723126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	17723126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysphasia	Dysphasia	CTD_human_DG	12690208		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Edema	Edema	Pubtator	34796748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embolism and Thrombosis	Embolism And Thrombosis	CTD_human_DG	9684808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28569122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26054531, 9009232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	15291813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	16465451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	30669988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30669988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31638164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	BEFREE	7579461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10452548, 11018526, 1704320, 3126194, 3137305, 9103395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28373474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39179711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16357523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	16357523, 18492260, 39179711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	30689698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31587659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	9104984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	21219580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	15604328	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	22352330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	22352330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	33641611	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	2953770, 33723576, 38103737	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemorrhage	Hemorrhage	Pubtator	32281768	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	26420861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29666986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	39595551	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	11317134, 11385207, 12484521, 19116134, 28619989, 28667504, 29705803, 31812956		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	22352330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	Pubtator	34210154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	BEFREE	7579461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	34210154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis Vulgaris	Ichthyosis vulgaris	Pubtator	8601722	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27564658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30093697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	12297567, 17690543, 18453163, 20547619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	16839347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28000518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26420861, 35806251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	28754830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Embolism and Thrombosis	Intracranial Embolism And Thrombosis	CTD_human_DG	7482654, 8427107		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Thrombosis	Intracranial Thrombosis	BEFREE	30208455, 30878103, 31713667		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Thrombosis	Intracranial Thrombosis	CTD_human_DG	8678742		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ischemic stroke	Ischemic Stroke	BEFREE	14983220, 16179568, 17689414, 17723126, 17961231, 20224056, 22240314, 23301636, 23326456, 27879445, 27887792, 28134031, 28379489, 28412317, 28446625 View all (60 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	38272772	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	18508579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	22352330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lethal hydranencephaly-diaphragmatic hernia syndrome	Lethal Hydranencephaly-Diaphragmatic Hernia Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	3497709, 8429689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10099141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1315765, 20444294, 30813635, 8389767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	2442199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	2442199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	1315765, 20444294, 8389767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21398193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	28714469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26150443, 37753740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	18468424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	10702388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28375203, 29348904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11555606, 11840342, 16277885, 2112958, 21964832, 24220687, 24498382, 28765903, 30112019, 30641217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26054531, 9009232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	7692948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31699117, 8641471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12420223, 12850144, 23715767, 9766566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	22491752, 28582759, 28992327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20428959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15356994, 17569214, 2440556, 26054531, 27569058, 30641217, 31288236, 7046911, 8097582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19636513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	7692948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mature B-Cell Neoplasm	B-Cell Neoplasm	BEFREE	12091133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11044361, 2117440, 27973546, 8034604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19636513, 8034604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23063511	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29348904, 31610810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31806434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	2555056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	22577291	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	12297567, 17690543, 18453163, 20547619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	30135678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	8601722	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21733935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	8446952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10426151, 15735559, 17986506, 24825926, 30135678, 8957442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	15793294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17986506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	30338901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	3092643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	22352330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	10171637, 10505926, 10645301, 10914357, 11382373, 11489769, 12074692, 12227717, 12848087, 1430592, 1492007, 15215796, 15301905, 18195371, 1898952 View all (18 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	10980830, 11848437, 23570848, 25113642, 28434774, 30035698, 31436141, 9193430, 9285181, 9327764, 9609233		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	11816707, 11848437		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	15119966, 15466927, 21624046	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	15670033	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	2953770, 8874999, 9559429	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	34796748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	11422656	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	23155140, 26067893, 36841712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	29431874, 35728655	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	29962211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18656687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10673028, 11444823, 11716547, 11875015, 12592382, 12889856, 14985701, 15356994, 16012519, 16357523, 16391790, 1715339, 17569214, 1868037, 1913677 View all (30 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus, Type I	Nephrogenic Diabetes Insipidus	BEFREE	8232694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	11340346		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	15569865, 27472425, 29167555, 30035698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	14963743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15342394, 16012519, 22411791, 7706255, 9218873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28925023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	14963743		★★★★★ ★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Non rare thrombophilia	Non Rare Thrombophilia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30093697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20051227, 28129994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	8646430	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	9370880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18473395		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	14529669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31699117, 8641471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	11875015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16733850, 17452424, 8641471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	16044159, 20454814, 22751111, 28073348, 28842350, 29525432, 29674280, 29844066, 3126183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	29304073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	15008985, 2121833, 8601722	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	2121833, 8601722	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Benign Familial	Benign familial pemphigus	Pubtator	2121833, 8601722	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	12589088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	CTD_human_DG	9633741		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritonitis	Peritonitis	Pubtator	11044361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	14562162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	31673364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	17661167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	17661167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	18029284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	6438157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	14562162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12420223, 12850144, 1868037, 21617851, 23715767, 9766566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	2466035, 26296974, 27689401, 28108419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	2121833, 31751638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	2121833, 8601722	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30093697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	40243422	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Thromboembolisms	Pulmonary thromboembolism	CTD_human_DG	1899825, 19415734, 2123154, 3105914, 3122266, 8082347, 8451030, 9199818, 9266785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Thromboembolisms	Pulmonary thromboembolism	BEFREE	30464403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	18037995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28739832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	CTD_human_DG	25331496		★★★★★ ★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 1	Retinitis Pigmentosa	BEFREE	1783394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12234381, 16351709, 20213728, 8037710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16356191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21898905, 30093697		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21898905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	27957319	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	28212865, 9269770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	8394731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	28073348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	14985701, 20599447, 21478324, 24345644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	24497664, 35887329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12889856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25620088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	11437413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	25310126		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	28831992, 28844990, 28928186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20428959, 8625219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	39762768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	25862260	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	34252155	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27031957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subcortical Infarction	Brain Infarction	CTD_human_DG	15502123, 1579960, 16148626, 18544249, 1899364, 9183334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30709025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	23334061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	25989112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboembolic stroke	Thromboembolic stroke	BEFREE	29850586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia, Familial, Due To Decreased Release Of Tissue Plasminogen Activator	Thrombophilia	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia, Familial, Due To Decreased Release Of Tissue Plasminogen Activator	Thrombophilia	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis	Thrombosis	Pubtator	11038326, 18258816, 33173052	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis	Thrombosis	Pubtator	36044519	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis	Thrombosis	Pubtator	7776475	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	28780236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37753740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	30647816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	29348904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15816639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	10686539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	25807501, 7776475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	8300642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30689698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasospasm, Intracranial	Intracranial Vasospasm	CTD_human_DG	19057314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Insufficiency	Venous insufficiency	Pubtator	10954203	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	33512476, 37762110, 39179711	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thrombosis	Venous thrombosis	Pubtator	25837651	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	28413515		★★★★★ ★☆☆☆☆ Found in Text Mining only

PLAT (plasminogen activator, tissue type)