Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5325
Gene name	PLAG1 like zinc finger 1
Gene symbol	PLAGL1
Synonyms (NCBI Gene)	LOT1ZACZAC1
Chromosome	6
Chromosome location	6q24.2
Summary	This gene encodes a C2H2 zinc finger protein that functions as a suppressor of cell growth. This gene is often deleted or methylated and silenced in cancer cells. In addition, overexpression of this gene during fetal development is thought to be the causa

Show/Hide all (84)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027731	hsa-miR-98-5p	Microarray	19088304
MIRT736255	hsa-miR-379-3p	Luciferase reporter assayWestern blottingMicroarrayNorthern blottingqRT-PCRFlow cytometry	32032531
MIRT736256	hsa-miR-410-3p	Luciferase reporter assayWestern blottingNorthern blottingqRT-PCRFlow cytometry	32032531
MIRT1239101	hsa-miR-125a-5p	CLIP-seq
MIRT1239102	hsa-miR-125b	CLIP-seq
MIRT1239103	hsa-miR-1270	CLIP-seq
MIRT1239104	hsa-miR-15a	CLIP-seq
MIRT1239105	hsa-miR-15b	CLIP-seq
MIRT1239106	hsa-miR-16	CLIP-seq
MIRT1239107	hsa-miR-195	CLIP-seq
MIRT1239108	hsa-miR-338-5p	CLIP-seq
MIRT1239109	hsa-miR-3927	CLIP-seq
MIRT1239110	hsa-miR-424	CLIP-seq
MIRT1239111	hsa-miR-425	CLIP-seq
MIRT1239112	hsa-miR-4319	CLIP-seq
MIRT1239113	hsa-miR-4434	CLIP-seq
MIRT1239114	hsa-miR-4516	CLIP-seq
MIRT1239115	hsa-miR-4524	CLIP-seq
MIRT1239116	hsa-miR-4531	CLIP-seq
MIRT1239117	hsa-miR-4650-3p	CLIP-seq
MIRT1239118	hsa-miR-4668-3p	CLIP-seq
MIRT1239119	hsa-miR-4732-3p	CLIP-seq
MIRT1239120	hsa-miR-4764-5p	CLIP-seq
MIRT1239121	hsa-miR-4781-3p	CLIP-seq
MIRT1239122	hsa-miR-493	CLIP-seq
MIRT1239123	hsa-miR-497	CLIP-seq
MIRT1239124	hsa-miR-503	CLIP-seq
MIRT1239125	hsa-miR-539	CLIP-seq
MIRT1239126	hsa-miR-548c-3p	CLIP-seq
MIRT1239127	hsa-miR-605	CLIP-seq
MIRT1239128	hsa-miR-620	CLIP-seq
MIRT1239129	hsa-miR-646	CLIP-seq
MIRT1239130	hsa-miR-670	CLIP-seq
MIRT1239131	hsa-miR-105	CLIP-seq
MIRT1239132	hsa-miR-4325	CLIP-seq
MIRT1239133	hsa-miR-520d-5p	CLIP-seq
MIRT1239134	hsa-miR-524-5p	CLIP-seq
MIRT1239101	hsa-miR-125a-5p	CLIP-seq
MIRT1239102	hsa-miR-125b	CLIP-seq
MIRT1239112	hsa-miR-4319	CLIP-seq
MIRT1239135	hsa-miR-4672	CLIP-seq
MIRT1239119	hsa-miR-4732-3p	CLIP-seq
MIRT1239130	hsa-miR-670	CLIP-seq
MIRT1239136	hsa-miR-335	CLIP-seq
MIRT1239137	hsa-miR-1271	CLIP-seq
MIRT1239138	hsa-miR-3664-3p	CLIP-seq
MIRT1239139	hsa-miR-4436a	CLIP-seq
MIRT1239140	hsa-miR-490-3p	CLIP-seq
MIRT1239141	hsa-miR-510	CLIP-seq
MIRT1239142	hsa-miR-649	CLIP-seq
MIRT1239143	hsa-miR-96	CLIP-seq
MIRT1239103	hsa-miR-1270	CLIP-seq
MIRT1239113	hsa-miR-4434	CLIP-seq
MIRT1239114	hsa-miR-4516	CLIP-seq
MIRT1239116	hsa-miR-4531	CLIP-seq
MIRT1239135	hsa-miR-4672	CLIP-seq
MIRT2070313	hsa-miR-513c	CLIP-seq
MIRT2070314	hsa-miR-514b-5p	CLIP-seq
MIRT1239125	hsa-miR-539	CLIP-seq
MIRT1239128	hsa-miR-620	CLIP-seq
MIRT2432147	hsa-miR-3658	CLIP-seq
MIRT2432148	hsa-miR-4662a-3p	CLIP-seq
MIRT1239129	hsa-miR-646	CLIP-seq
MIRT1239104	hsa-miR-15a	CLIP-seq
MIRT1239105	hsa-miR-15b	CLIP-seq
MIRT1239106	hsa-miR-16	CLIP-seq
MIRT1239107	hsa-miR-195	CLIP-seq
MIRT2688000	hsa-miR-2114	CLIP-seq
MIRT1239108	hsa-miR-338-5p	CLIP-seq
MIRT1239110	hsa-miR-424	CLIP-seq
MIRT1239111	hsa-miR-425	CLIP-seq
MIRT2688001	hsa-miR-4420	CLIP-seq
MIRT2688002	hsa-miR-4427	CLIP-seq
MIRT1239115	hsa-miR-4524	CLIP-seq
MIRT2688003	hsa-miR-4676-5p	CLIP-seq
MIRT2688004	hsa-miR-4753-3p	CLIP-seq
MIRT1239120	hsa-miR-4764-5p	CLIP-seq
MIRT1239121	hsa-miR-4781-3p	CLIP-seq
MIRT1239123	hsa-miR-497	CLIP-seq
MIRT1239124	hsa-miR-503	CLIP-seq
MIRT2070313	hsa-miR-513c	CLIP-seq
MIRT2070314	hsa-miR-514b-5p	CLIP-seq
MIRT2688005	hsa-miR-575	CLIP-seq
MIRT1239129	hsa-miR-646	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
TP53	Unknown	11896574

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	9671765
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9671765
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0002682	Process	Regulation of immune system process	IBA
GO:0003677	Function	DNA binding	IDA	15888726
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006915	Process	Apoptotic process	TAS	9671765
GO:0008270	Function	Zinc ion binding	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016604	Component	Nuclear body	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15888726
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9671765
GO:0046872	Function	Metal ion binding	IEA
GO:0051726	Process	Regulation of cell cycle	TAS	9184226

MIM	HGNC	e!Ensembl
603044	9046	ENSG00000118495

Q9UM63

Protein name

Zinc finger protein PLAGL1 (Lost on transformation 1) (LOT-1) (Pleiomorphic adenoma-like protein 1) (Tumor suppressor ZAC)

Protein function

Acts as a transcriptional activator (PubMed:9722527). Involved in the transcriptional regulation of type 1 receptor for pituitary adenylate cyclase-activating polypeptide.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	32 → 56	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	62 → 84	Zinc finger, C2H2 type	Domain

Sequence

MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK
SHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL
TCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTG
CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALP
PFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPN
HKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVN
LPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ
QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR

Sequence length

463

Interactions

View interactions

	Reactome
			TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TRANSIENT NEONATAL, 1	—	CTD, ClinVar CTD, ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLAGL1-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSIENT NEONATAL DIABETES MELLITUS	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSITORY NEONATAL DIABETES MELLITUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (121)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromegaly	Acromegaly	Pubtator	19637311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	23847328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15581945, 25091631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	16733217, 21872827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	20175198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	26633653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	16179495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	15888726, 19092779, 26505556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	LHGDN	15888726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy	Bladder Exstrophy	BEFREE	27223093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10435621, 12473647, 15581945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11297535, 28791367, 36788602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32678267	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16179495, 28957425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	24260468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	16179495, 32678267	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16179495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	16179495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15581945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	36437415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	16112421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	23477525	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28302090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26134521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	20518900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26851016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22784302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30197757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	19155788, 24316753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	24316753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24316753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12473647, 24316753, 24993786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24316753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Transient Neonatal 1	Diabetes mellitus transient neonatal	Pubtator	11297535, 19092779, 24316753, 28957425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Transient Neonatal 1	Diabetes mellitus transient neonatal	Pubtator	27075368	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16012265, 30098304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Transient Neonatal, 1	Diabetes Mellitus	BEFREE	10655556, 10936046, 11297535, 12119104, 15286800, 22547676		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Transient Neonatal, 1	Diabetes Mellitus	ORPHANET_DG	20803656, 21844708		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	20175198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	16112421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Funisitis (disorder)	Funisitis	BEFREE	23477525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	17552003, 25091631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized myoclonic seizures	Myoclonic Seizures	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20879984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	12473647, 24316753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	28835453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	22784302, 32693431, 33407475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	22784302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	LHGDN	17805016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	21872827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12473647, 16179495	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	12471198, 20668833		★★★★★ ★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	12471198, 20668833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	22547676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	24260468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Atresia	Intestinal Atresia	LHGDN	15592663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketonuria	Ketonuria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	24260468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	24260468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	24260468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12878869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macroglossia	Macroglossia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10435621, 12473647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15581945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25091631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11156367, 12473647, 15581945, 23477525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10435621, 11297535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	23415968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal diabetes mellitus	Diabetes Mellitus	BEFREE	12119104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10435621, 11313869, 11888928, 12473647, 15054737, 15560839, 15751035, 15888726, 16112421, 16179495, 17332914, 17805016, 19489030, 20175198, 20518900 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24158121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24158121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15581945		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15581945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32678267	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36600208	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	27178226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Paternal uniparental disomy of chromosome 6	Paternal Uniparental Disomy Of Chromosome 6	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Paternal uniparental disomy of chromosome 6	Paternal Uniparental Disomy Of Chromosome 6	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	21872827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	20117169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	19637311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	24098585, 32678267	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24513574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism Type 1B	Pseudohypoparathyroidism	Pubtator	19092779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23660957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Riboflavin Deficiency	Riboflavin deficiency	Pubtator	16109485	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	19694203, 20082469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24260468		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	24260468	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	15054737, 16179495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15054737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	24260468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28781677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 17552003	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tonic - clonic seizures	Seizure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient neonatal diabetes mellitus	Diabetes Mellitus	BEFREE	10655556, 11297535, 11448939, 11935319, 12473647, 15888726, 19155788, 22547676, 24316753, 28985358		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transient neonatal diabetes mellitus	Diabetes Mellitus	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transient neonatal diabetes mellitus	Diabetes Mellitus	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18217980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32678267	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	22784302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

PLAGL1 (PLAG1 like zinc finger 1)