Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5322
Gene name	Phospholipase A2 group V
Gene symbol	PLA2G5
Synonyms (NCBI Gene)	FRFBGV-PLA2PLA2-10hVPLA(2)
Chromosome	1
Chromosome location	1p36.13
Summary	This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs200954922	C>T	Affects	Coding sequence variant, stop gained
rs387906795	G>A,T	Affects	Coding sequence variant, missense variant
rs387906796	G>A	Affects	Coding sequence variant, missense variant
rs746408116	G>A	Affects	Stop gained, coding sequence variant
rs766454085	A>-	Affects	3 prime UTR variant, frameshift variant, coding sequence variant
rs1569848362	->G	Pathogenic	Frameshift variant, coding sequence variant

101

Show/Hide all (101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021933	hsa-miR-128-3p	Microarray	17612493
MIRT441766	hsa-miR-3125	PAR-CLIP	22100165
MIRT441767	hsa-miR-3916	PAR-CLIP	22100165
MIRT441765	hsa-miR-6859-5p	PAR-CLIP	22100165
MIRT441764	hsa-miR-6847-5p	PAR-CLIP	22100165
MIRT441763	hsa-miR-922	PAR-CLIP	22100165
MIRT441762	hsa-miR-2467-3p	PAR-CLIP	22100165
MIRT441761	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT441766	hsa-miR-3125	PAR-CLIP	22100165
MIRT441767	hsa-miR-3916	PAR-CLIP	22100165
MIRT441765	hsa-miR-6859-5p	PAR-CLIP	22100165
MIRT441764	hsa-miR-6847-5p	PAR-CLIP	22100165
MIRT441763	hsa-miR-922	PAR-CLIP	22100165
MIRT441762	hsa-miR-2467-3p	PAR-CLIP	22100165
MIRT441761	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT441766	hsa-miR-3125	PAR-CLIP	22100165
MIRT441767	hsa-miR-3916	PAR-CLIP	22100165
MIRT441765	hsa-miR-6859-5p	PAR-CLIP	22100165
MIRT441764	hsa-miR-6847-5p	PAR-CLIP	22100165
MIRT441763	hsa-miR-922	PAR-CLIP	22100165
MIRT441762	hsa-miR-2467-3p	PAR-CLIP	22100165
MIRT441761	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT441766	hsa-miR-3125	PAR-CLIP	22100165
MIRT441767	hsa-miR-3916	PAR-CLIP	22100165
MIRT441765	hsa-miR-6859-5p	PAR-CLIP	22100165
MIRT441764	hsa-miR-6847-5p	PAR-CLIP	22100165
MIRT441763	hsa-miR-922	PAR-CLIP	22100165
MIRT441762	hsa-miR-2467-3p	PAR-CLIP	22100165
MIRT441761	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT1238804	hsa-miR-1179	CLIP-seq
MIRT1238805	hsa-miR-1253	CLIP-seq
MIRT1238806	hsa-miR-1264	CLIP-seq
MIRT1238807	hsa-miR-1266	CLIP-seq
MIRT1238808	hsa-miR-1293	CLIP-seq
MIRT1238809	hsa-miR-136	CLIP-seq
MIRT1238810	hsa-miR-28-5p	CLIP-seq
MIRT1238811	hsa-miR-302a	CLIP-seq
MIRT1238812	hsa-miR-302b	CLIP-seq
MIRT1238813	hsa-miR-302c	CLIP-seq
MIRT1238814	hsa-miR-302d	CLIP-seq
MIRT1238815	hsa-miR-302e	CLIP-seq
MIRT1238816	hsa-miR-3074-3p	CLIP-seq
MIRT1238817	hsa-miR-3139	CLIP-seq
MIRT1238818	hsa-miR-3192	CLIP-seq
MIRT1238819	hsa-miR-326	CLIP-seq
MIRT1238820	hsa-miR-330-5p	CLIP-seq
MIRT1238821	hsa-miR-3664-3p	CLIP-seq
MIRT1238822	hsa-miR-3668	CLIP-seq
MIRT1238823	hsa-miR-3689a-3p	CLIP-seq
MIRT1238824	hsa-miR-3689c	CLIP-seq
MIRT1238825	hsa-miR-372	CLIP-seq
MIRT1238826	hsa-miR-373	CLIP-seq
MIRT1238827	hsa-miR-4251	CLIP-seq
MIRT1238828	hsa-miR-4310	CLIP-seq
MIRT1238829	hsa-miR-4314	CLIP-seq
MIRT1238830	hsa-miR-4483	CLIP-seq
MIRT1238831	hsa-miR-4518	CLIP-seq
MIRT1238832	hsa-miR-4527	CLIP-seq
MIRT1238833	hsa-miR-4646-5p	CLIP-seq
MIRT1238834	hsa-miR-4652-3p	CLIP-seq
MIRT1238835	hsa-miR-4728-5p	CLIP-seq
MIRT1238836	hsa-miR-515-5p	CLIP-seq
MIRT1238837	hsa-miR-516b	CLIP-seq
MIRT1238838	hsa-miR-519a	CLIP-seq
MIRT1238839	hsa-miR-519b-3p	CLIP-seq
MIRT1238840	hsa-miR-519c-3p	CLIP-seq
MIRT1238841	hsa-miR-520a-3p	CLIP-seq
MIRT1238842	hsa-miR-520b	CLIP-seq
MIRT1238843	hsa-miR-520c-3p	CLIP-seq
MIRT1238844	hsa-miR-520d-3p	CLIP-seq
MIRT1238845	hsa-miR-520e	CLIP-seq
MIRT1238846	hsa-miR-548c-3p	CLIP-seq
MIRT1238847	hsa-miR-708	CLIP-seq
MIRT1238848	hsa-miR-765	CLIP-seq
MIRT1238849	hsa-miR-873	CLIP-seq
MIRT2070261	hsa-miR-1254	CLIP-seq
MIRT2070262	hsa-miR-127-5p	CLIP-seq
MIRT2070263	hsa-miR-3116	CLIP-seq
MIRT2070264	hsa-miR-320e	CLIP-seq
MIRT2070265	hsa-miR-590-3p	CLIP-seq
MIRT2070266	hsa-miR-671-5p	CLIP-seq
MIRT1238805	hsa-miR-1253	CLIP-seq
MIRT2297528	hsa-miR-298	CLIP-seq
MIRT1238811	hsa-miR-302a	CLIP-seq
MIRT1238812	hsa-miR-302b	CLIP-seq
MIRT1238813	hsa-miR-302c	CLIP-seq
MIRT1238814	hsa-miR-302d	CLIP-seq
MIRT1238815	hsa-miR-302e	CLIP-seq
MIRT1238825	hsa-miR-372	CLIP-seq
MIRT1238826	hsa-miR-373	CLIP-seq
MIRT1238827	hsa-miR-4251	CLIP-seq
MIRT1238838	hsa-miR-519a	CLIP-seq
MIRT1238839	hsa-miR-519b-3p	CLIP-seq
MIRT1238840	hsa-miR-519c-3p	CLIP-seq
MIRT1238841	hsa-miR-520a-3p	CLIP-seq
MIRT1238842	hsa-miR-520b	CLIP-seq
MIRT1238843	hsa-miR-520c-3p	CLIP-seq
MIRT1238844	hsa-miR-520d-3p	CLIP-seq
MIRT1238845	hsa-miR-520e	CLIP-seq
MIRT2392592	hsa-miR-3183	CLIP-seq
MIRT2392593	hsa-miR-4723-3p	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005543	Function	Phospholipid binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	8300559
GO:0005768	Component	Endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	TAS	8300559
GO:0006909	Process	Phagocytosis	IEA
GO:0009395	Process	Phospholipid catabolic process	IEA
GO:0010518	Process	Positive regulation of phospholipase activity	IDA	22837859
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	ISS
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019370	Process	Leukotriene biosynthetic process	IDA	20432503
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032009	Component	Early phagosome	ISS
GO:0032010	Component	Phagolysosome	ISS
GO:0034374	Process	Low-density lipoprotein particle remodeling	ISS
GO:0034638	Process	Phosphatidylcholine catabolic process	IDA	23533611
GO:0042130	Process	Negative regulation of T cell proliferation	IBA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0046470	Process	Phosphatidylcholine metabolic process	IBA
GO:0046470	Process	Phosphatidylcholine metabolic process	IEA
GO:0046471	Process	Phosphatidylglycerol metabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IBA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	TAS	8300559
GO:0047499	Function	Calcium-independent phospholipase A2 activity	IDA	23533611
GO:0050482	Process	Arachidonate secretion	IEA
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0055037	Component	Recycling endosome	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	22837859
GO:0090265	Process	Positive regulation of immune complex clearance by monocytes and macrophages	IDA	20432503
GO:0090385	Process	Phagosome-lysosome fusion	ISS
GO:1903028	Process	Positive regulation of opsonization	ISS
GO:1905036	Process	Positive regulation of antifungal innate immune response	ISS
GO:1905164	Process	Positive regulation of phagosome maturation	ISS

MIM	HGNC	e!Ensembl
601192	9038	ENSG00000127472

P39877

Protein name

Phospholipase A2 group V (EC 3.1.1.4) (PLA2-10) (Phosphatidylcholine 2-acylhydrolase 5)

Protein function

Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids (PubMed:8300559). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity), preferent

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00068	Phospholip_A2_1	22 → 130	Phospholipase A2	Domain

Tissue specificity

TISSUE SPECIFICITY: Heart, placenta and less abundantly, in lung. Detected in the outer and inner plexiform layers of the retina (at protein level) (PubMed:22137173). Expressed in monocytes and macrophages (PubMed:25725101). {ECO:0000269|PubMed:22137173,

Sequence

MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGT
DWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKR
NLRSYNPQYQYFPNILCS

Sequence length

138

Interactions

View interactions

	KEGG		Reactome
	Glycerophospholipid metabolism Ether lipid metabolism Arachidonic acid metabolism Linoleic acid metabolism alpha-Linolenic acid metabolism Metabolic pathways Ras signaling pathway Vascular smooth muscle contraction Pancreatic secretion Fat digestion and absorption		Acyl chain remodelling of PC Acyl chain remodelling of PS Acyl chain remodelling of PE Acyl chain remodelling of PI Acyl chain remodelling of PG Synthesis of PA

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Late-onset retinal degeneration	Pathogenic	rs1569848362	RCV001003122	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial benign flecked retina	Uncertain significance; Affects; Conflicting classifications of pathogenicity	ClinVar ClinVar, GWAS catalog, Orphanet ClinVar, GWAS catalog, Orphanet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA, LATE-ADULT ONSET	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	26715269	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36102738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24563418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24563418, 24959594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24959594, 37239897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24563418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27293319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	29346348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial benign flecked retina	Benign Flecked Retina	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Fleck Retina, Familial Benign	Fleck Retina	ORPHANET_DG	22137173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck Retina, Familial Benign	Fleck Retina	UNIPROT_DG	22137173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck Retina, Familial Benign	Fleck Retina	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck Retina, Familial Benign	Fleck Retina	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck Retina, Familial Benign	Fleck Retina	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31114356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24959594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24959594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20083228, 31114356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22137173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24910243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36102738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26715269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30103930		★★★★★ ★☆☆☆☆ Found in Text Mining only

PLA2G5 (phospholipase A2 group V)