PKM (pyruvate kinase M1/2)

Gene

• Entrez ID: 5315
• Gene name: Pyruvate kinase M1/2
• Gene symbol: PKM
• Synonyms (NCBI Gene): CTHBP, HEL-S-30, OIP3, PK3, PKM2, TCB, THBP1, p58
• Chromosome: 15
• Chromosome location: 15q23
• Summary: This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001816	hsa-miR-133a-3p	Immunohistochemistry	18464261
MIRT001815	hsa-miR-133b	Immunohistochemistry	18464261
MIRT005520	hsa-miR-326	Luciferase reporter assay, qRT-PCR, Western blot	20667897
MIRT005520	hsa-miR-326	Luciferase reporter assay, qRT-PCR, Western blot	20667897
MIRT005520	hsa-miR-326	Luciferase reporter assay, qRT-PCR, Western blot	20667897
MIRT005520	hsa-miR-326	Luciferase reporter assay, qRT-PCR, Western blot	20667897
MIRT001815	hsa-miR-133b	Other	18464261
MIRT001816	hsa-miR-133a-3p	Other	18464261
MIRT023396	hsa-miR-122-5p	Microarray	17612493
MIRT028653	hsa-miR-30a-5p	Proteomics	18668040
MIRT050390	hsa-miR-23a-3p	CLASH	23622248
MIRT049024	hsa-miR-92a-3p	CLASH	23622248
MIRT049024	hsa-miR-92a-3p	CLASH	23622248
MIRT047865	hsa-miR-30c-5p	CLASH	23622248
MIRT046929	hsa-miR-221-3p	CLASH	23622248
MIRT046680	hsa-miR-222-3p	CLASH	23622248
MIRT046680	hsa-miR-222-3p	CLASH	23622248
MIRT046067	hsa-miR-125b-5p	CLASH	23622248
MIRT046067	hsa-miR-125b-5p	CLASH	23622248
MIRT044585	hsa-miR-320a	CLASH	23622248
MIRT043843	hsa-miR-330-3p	CLASH	23622248
MIRT043754	hsa-miR-328-3p	CLASH	23622248
MIRT005520	hsa-miR-326	CLASH	23622248
MIRT042876	hsa-miR-324-3p	CLASH	23622248
MIRT042646	hsa-miR-423-3p	CLASH	23622248
MIRT041665	hsa-miR-484	CLASH	23622248
MIRT041665	hsa-miR-484	CLASH	23622248
MIRT041665	hsa-miR-484	CLASH	23622248
MIRT040961	hsa-miR-18a-3p	CLASH	23622248
MIRT039183	hsa-miR-769-5p	CLASH	23622248
MIRT039032	hsa-miR-766-3p	CLASH	23622248
MIRT038436	hsa-miR-296-3p	CLASH	23622248
MIRT038155	hsa-miR-423-5p	CLASH	23622248
MIRT036965	hsa-miR-877-3p	CLASH	23622248
MIRT036697	hsa-miR-935	CLASH	23622248
MIRT036045	hsa-miR-1301-3p	CLASH	23622248
MIRT036045	hsa-miR-1301-3p	CLASH	23622248
MIRT052783	hsa-miR-1260b	CLASH	23622248
MIRT052808	hsa-miR-3187-3p	CLASH	23622248
MIRT023396	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR, Western blot	24466275
MIRT023396	hsa-miR-122-5p	PAR-CLIP	23592263
MIRT470969	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT470968	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT470967	hsa-miR-4650-5p	PAR-CLIP	23592263
MIRT470966	hsa-miR-199a-3p	PAR-CLIP	23592263
MIRT470965	hsa-miR-199b-3p	PAR-CLIP	23592263
MIRT470964	hsa-miR-3129-5p	PAR-CLIP	23592263
MIRT470963	hsa-miR-4254	PAR-CLIP	23592263
MIRT470962	hsa-miR-17-3p	PAR-CLIP	23592263
MIRT470961	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT470960	hsa-miR-3659	PAR-CLIP	23592263
MIRT470959	hsa-miR-1254	PAR-CLIP	23592263
MIRT470958	hsa-miR-3116	PAR-CLIP	23592263
MIRT470957	hsa-miR-4533	PAR-CLIP	23592263
MIRT470956	hsa-miR-3202	PAR-CLIP	23592263
MIRT470955	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT470954	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT470953	hsa-miR-3689d	PAR-CLIP	23592263
MIRT470952	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT470951	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT470950	hsa-miR-6822-3p	PAR-CLIP	23592263
MIRT470949	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT470948	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT470947	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT470946	hsa-miR-5698	PAR-CLIP	23592263
MIRT470945	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT470944	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT470943	hsa-miR-4525	PAR-CLIP	23592263
MIRT470942	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT470941	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT470940	hsa-miR-6745	PAR-CLIP	23592263
MIRT470939	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT470938	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT470937	hsa-miR-4447	PAR-CLIP	23592263
MIRT470936	hsa-miR-4472	PAR-CLIP	23592263
MIRT470935	hsa-miR-4727-3p	PAR-CLIP	23592263
MIRT470934	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT470933	hsa-miR-1275	PAR-CLIP	23592263
MIRT470932	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT470931	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT439960	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439960	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT001815	hsa-miR-133b	Western blot	27073574
MIRT001815	hsa-miR-133b	Western blot	27073574
MIRT001815	hsa-miR-133b	qRT-PCR, Western blot	28641694
MIRT470955	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT470955	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT470933	hsa-miR-1275	PAR-CLIP	26701625
MIRT470956	hsa-miR-3202	PAR-CLIP	26701625
MIRT005520	hsa-miR-326	PAR-CLIP	26701625
MIRT737182	hsa-miR-330-5p	PAR-CLIP	26701625
MIRT470943	hsa-miR-4525	PAR-CLIP	26701625
MIRT470932	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT470947	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT470942	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT470946	hsa-miR-5698	PAR-CLIP	26701625
MIRT470948	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT470934	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT470934	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT470954	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT470954	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT470961	hsa-miR-6804-5p	PAR-CLIP	26701625
MIRT470961	hsa-miR-6804-5p	PAR-CLIP	26701625
MIRT470945	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT470944	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT470938	hsa-miR-7847-3p	PAR-CLIP	26701625
MIRT470938	hsa-miR-7847-3p	PAR-CLIP	26701625
MIRT737182	hsa-miR-330-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31956955
MIRT023396	hsa-miR-122-5p	PAR-CLIP	23592263
MIRT470969	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT470968	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT470967	hsa-miR-4650-5p	PAR-CLIP	23592263
MIRT470966	hsa-miR-199a-3p	PAR-CLIP	23592263
MIRT470965	hsa-miR-199b-3p	PAR-CLIP	23592263
MIRT470964	hsa-miR-3129-5p	PAR-CLIP	23592263
MIRT470963	hsa-miR-4254	PAR-CLIP	23592263
MIRT470962	hsa-miR-17-3p	PAR-CLIP	23592263
MIRT470961	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT470960	hsa-miR-3659	PAR-CLIP	23592263
MIRT470959	hsa-miR-1254	PAR-CLIP	23592263
MIRT470958	hsa-miR-3116	PAR-CLIP	23592263
MIRT470957	hsa-miR-4533	PAR-CLIP	23592263
MIRT470956	hsa-miR-3202	PAR-CLIP	23592263
MIRT470955	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT470954	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT470953	hsa-miR-3689d	PAR-CLIP	23592263
MIRT470952	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT470951	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT470950	hsa-miR-6822-3p	PAR-CLIP	23592263
MIRT470949	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT470948	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT470947	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT470946	hsa-miR-5698	PAR-CLIP	23592263
MIRT470945	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT470944	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT470943	hsa-miR-4525	PAR-CLIP	23592263
MIRT470942	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT470941	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT470940	hsa-miR-6745	PAR-CLIP	23592263
MIRT470939	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT470938	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT470937	hsa-miR-4447	PAR-CLIP	23592263
MIRT470936	hsa-miR-4472	PAR-CLIP	23592263
MIRT470935	hsa-miR-4727-3p	PAR-CLIP	23592263
MIRT470934	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT470933	hsa-miR-1275	PAR-CLIP	23592263
MIRT470932	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT470931	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT755902	hsa-miR-489-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34868902

Transcription factors

Transcription factor	Regulation	Reference
ZBTB7A	Repression	25184678

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0003713	Function	Transcription coactivator activity	IDA	22056988
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003729	Function	MRNA binding	IEA
GO:0003729	Function	MRNA binding	ISS
GO:0003824	Function	Catalytic activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	22306293, 24120661
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004743	Function	Pyruvate kinase activity	IBA
GO:0004743	Function	Pyruvate kinase activity	IDA	20005212, 20847263, 22056988
GO:0004743	Function	Pyruvate kinase activity	IEA
GO:0004743	Function	Pyruvate kinase activity	TAS	2040271, 2813362, 2854097
GO:0005515	Function	Protein binding	IPI	12620389, 17500595, 17620599, 18191611, 18298799, 18519040, 21044950, 21620138, 21725354, 22056988, 23355646, 24606918, 27199445, 27573352, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	22901803, 24120661
GO:0005634	Component	Nucleus	IDA	17308100, 18191611, 22056988, 27573352
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18298799, 22056988, 27573352
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005791	Component	Rough endoplasmic reticulum	IEA
GO:0005791	Component	Rough endoplasmic reticulum	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	NAS	2813362
GO:0005829	Component	Cytosol	TAS
GO:0005929	Component	Cilium	IEA
GO:0006096	Process	Glycolytic process	IBA
GO:0006096	Process	Glycolytic process	IDA	20847263
GO:0006096	Process	Glycolytic process	IEA
GO:0006096	Process	Glycolytic process	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0012501	Process	Programmed cell death	IDA	17308100
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0023026	Function	MHC class II protein complex binding	HDA	20458337
GO:0030955	Function	Potassium ion binding	IEA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032869	Process	Cellular response to insulin stimulus	IBA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035402	Function	Histone H3T11 kinase activity	IDA	22901803
GO:0035402	Function	Histone H3T11 kinase activity	IDA	22901803, 24120661
GO:0042803	Function	Protein homodimerization activity	IDA	22306293, 24120661
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	22056988, 22901803, 24120661
GO:0046872	Function	Metal ion binding	IEA
GO:0061621	Process	Canonical glycolysis	IEA
GO:0070062	Component	Extracellular exosome	HDA	11487543, 12519789, 19056867, 19199708, 20458337, 21362503, 23533145
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IMP	27199445
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2000767	Process	Positive regulation of cytoplasmic translation	IEA
GO:2000767	Process	Positive regulation of cytoplasmic translation	ISS

Other IDs

• MIM: 179050
• HGNC: 9021
• e!Ensembl: ENSG00000067225

Protein

• UniProt ID: P14618
• Protein name: Pyruvate kinase PKM (EC 2.7.1.40) (Cytosolic thyroid hormone-binding protein) (CTHBP) (Opa-interacting protein 3) (OIP-3) (Pyruvate kinase 2/3) (Pyruvate kinase muscle isozyme) (Threonine-protein kinase PKM2) (EC 2.7.11.1) (Thyroid hormone-binding protein
• Protein function: Catalyzes the final rate-limiting step of glycolysis by mediating the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) to ADP, generating ATP (PubMed:15996096, PubMed:1854723, PubMed:20847263). The ratio between the highly active te
• PDB: 1T5A, 1ZJH, 3BJF, 3BJT, 3G2G, 3GQY, 3GR4, 3H6O, 3ME3, 3SRD, 3SRF, 3SRH, 3U2Z, 4B2D, 4FXF, 4FXJ, 4G1N, 4JPG, 4QG6, 4QG8, 4QG9, 4QGC, 4RPP, 4WJ8, 4YJ5, 5X0I, 5X1V, 5X1W, 6B6U, 6GG3, 6GG4, 6GG5, 6GG6, 6JFB, 6NU1, 6NU5, 6NUB, 6TTF, 6TTH, 6TTI, 6TTQ, 6V74, 6V75, 6V76, 6WP3, 6WP4, 6WP5, 6WP6, 7L21, 8G2E, 8HGF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00224	PK	42 → 395	Pyruvate kinase, barrel domain	Family
  PF02887	PK_C	410 → 528	Pyruvate kinase, alpha/beta domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform M2]: Specifically expressed in proliferating cells, such as embryonic stem cells, embryonic carcinoma cells, as well as cancer cells. {ECO:0000269|PubMed:18191611, ECO:0000269|PubMed:18337823}.; TISSUE SPECIFICITY: [Isoform M1
• Sequence:

  MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVET
  LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIR
  TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
  ISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
  FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
  IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
  LSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEAS
  FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE
  AWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP

• Sequence length: 531

Pathways

KEGG:

Glycolysis / Gluconeogenesis
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Type II diabetes mellitus
Human papillomavirus infection
Viral carcinogenesis
Central carbon metabolism in cancer

Reactome:

Neutrophil degranulation
Glycolysis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	22087286, 22912555, 27683215		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26501265, 28489603, 29713182, 30925904, 31570790		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	24569090		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	28183315		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30578620, 35987203, 37454217	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★☆☆☆☆ Found in Text Mining only
Anaplastic Large Cell Lymphoma, ALK-Positive	Anaplastic Lymphoma	BEFREE	28414323		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	25880801		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	29636835	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26234680, 26500118, 29335522, 31311829, 31819190		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	32633891	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27903739, 29732501, 31480861, 31607752		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35256696, 36059477	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31466915		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27903739, 29732501, 31480861, 31607752		★☆☆☆☆ Found in Text Mining only
Atypical Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	29153060		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31217348, 31761564		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24817408, 25411978, 25661370, 30193222, 30651766		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	40085946	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28378811, 28380435, 29512924, 29695915, 30221356, 30249877, 30443191, 31246990		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	24492614		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25412762, 28035139		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32372141	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18559534, 22580449, 23130662, 24120138, 26339369, 26493994, 26715276, 26926077, 27911861, 29104286, 29145305, 29162853, 29925919, 30368881, 31141164, 31178738, 31343107, 31750963		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22874552	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25768091, 26291325, 26339369, 26607846, 26926077, 29073069, 29162853, 29343208, 30911680, 31372790, 33950928, 34136566, 34269158, 35246504, 35328104, 36193432, 36305548, 36797689, 38176460, 39242716	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26493994, 33294309	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23840737, 24120661, 26092770, 26339369, 26501265, 26617865, 26860615, 26989901, 27810895, 28183315, 28235245, 29127353, 33950928, 33991457, 35241524, 37212467, 39456901	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	22912555, 24884829, 26992222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23515579, 24466275, 24716919, 24895527, 25576919, 27203546, 28394882, 28726775, 29127353, 29514980, 30176945, 30180863, 30463528, 30482855, 30755064, 30852741, 32487192, 32572027, 34440687, 35764883, 36116159, 36168627, 36476366, 36529521, 37212467, 37234166, 37594129, 38218456, 40159482	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	36797689	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28378811, 28380435, 29512924, 29695915, 30221356, 30249877, 30443191, 31246990		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20336315, 25813626, 28418088, 29713182, 30728290, 31656668		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26234680, 26385349, 31311829	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31717694	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32991423, 38097666	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25964202, 28281967, 28346425, 28753677, 29277786, 29558748, 29752805		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26926996	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29869055		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28415668, 30323675, 31114449		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27916907, 28415668, 30323675, 31114449		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	24569090		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	27203546, 31303531	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28415668, 29707118, 31115511		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	1409635		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	27431728		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	22580449		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24817408, 31462699		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22807066, 24898807, 25732087, 28829588, 30787272		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	21789790	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18789002		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	34564978	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22807066, 24619225, 24686087, 25818238, 25955657, 26252736, 26542452, 27573352, 28498807, 28543190, 28746922, 30155759, 30259036, 30996297		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12820312, 17406361		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25313085, 25955657, 26506517, 26542452, 26617865, 28049773, 28746922, 29739823, 33386794, 33495406, 34336555, 34791830, 35408903, 35610475, 37124724, 37148838	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	29312595		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	26679756		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26876154, 27431728, 28337374, 29882248, 30160042, 30745848		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26926996	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24817408, 29273328		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	31454256		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29356574		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	28183315		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	28183315	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28436957		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28436957		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31076418	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30556500		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36120453	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28436957, 29574544, 29602394		★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	22087286	Associate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	26234680	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31756939		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	29153060		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31756939, 37612452	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29290767, 31554233		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25471892, 31554233	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29290767, 31554233		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26404132, 27384996, 29916308, 32945483, 36514094, 37679788	Associate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	30216369		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31411894		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29462566, 30455376, 31411894		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30970216		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	37454217	Stimulate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27283076, 27911861, 30105813		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	27283076, 30105813, 38301910	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	26509967		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	26509967	Associate	★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	LHGDN	17011640		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20667897, 23123196, 24077665, 26172294, 26874904, 27485204, 27602585, 28035139, 30297868, 30989436, 31632919		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20667897, 23155487, 24077665, 26874904, 30989436, 33221711, 38514913	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23451252, 37420311	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20667897, 23123196, 23451252, 26172294, 26874904, 27485204, 27602585, 28035139, 30297868, 30989436, 31632919		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20667897, 23123196, 23451252, 23840737, 24481450, 25948776, 26874904, 28035139, 28858851, 31181442		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20667897, 26874904, 34573317, 36865483	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23451252, 23840737, 35241524	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29463646	Inhibit	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	39904903	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease XII	Glycogen storage disease	Pubtator	21931771	Associate	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	LHGDN	18394773		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	35720300	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	30068946, 31675998		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24077665	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	30068946, 31675998	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	39817549	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	35328104	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31076418		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	31076418	Associate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	27903739, 31480861, 31607752		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38166707	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28972001		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	32992783	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24344305, 24561986, 30216369, 37277450	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27203546, 33456577, 35764883	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30911983		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28971999		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30027497		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	19097497		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29273328		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	22087286		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31303531		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29273328		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31782597		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	28414323		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31717694	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25215489, 30906218		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	30906218, 32546972, 33473116	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30906218	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30906218		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	27467582, 29104286		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18813785, 22617155, 23515579, 24466275, 24716919, 25514599, 25541689, 25576919, 25661370, 26252254, 26290635, 28394882, 28726775, 29127353, 29262861, 29545180, 30127967, 30257387, 30365092, 30430110, 30463528, 30475643, 30503555, 30809309, 30852741, 30858544, 31004447, 31086462, 31101057, 31106002, 31469916, 31735334, 9692838		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	19363144		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	29127353	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28630053, 28726775, 9692838		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12820320		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27593857, 28778925, 38097666	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35000669	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26339369, 26464675, 36897686	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	20927531		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	20927531		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30068946, 31675998		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18559534, 22580449, 23130662, 24120138, 26339369, 26493994, 26715276, 26926077, 27911861, 29104286, 29145305, 29162853, 29925919, 30368881, 31141164, 31178738, 31343107, 31750963		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31756939		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29290767, 31554233		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	27283076, 27911861		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31717694, 31814765		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25661370, 26376677, 27167190, 27203546, 29449541, 29858084, 30140938		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20336315, 25813626, 28418088, 29713182, 30728290, 31656668		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25964202, 28281967, 28346425, 28753677, 29277786, 29558748, 29752805		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25411978, 26112218, 26739387, 27911861, 28569774, 29374159, 29540198, 31527446, 31689601		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24884829, 27696457, 28994148, 29094170, 29736561, 30072740, 30216369, 31135122, 31548301		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	25961580		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22627140, 22912555, 26745603, 28235245, 28588255, 29032577, 29541204, 29997453, 30417413, 31000383		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25880801, 30018720, 31669575		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28378811, 28380435, 29512924, 29695915, 30221356, 30249877, 30443191, 31246990		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20010808, 20507318, 20667897, 21709315, 21789790, 22140559, 22293754, 22626471, 22824010, 22912555, 23071355, 23791887, 23837608, 23840737, 23901116, 24077665, 24120138, 24142698, 24481450, 24492614, 24508027, 24569090, 24747424, 24972138, 25064846, 25070887, 25078136, 25233397, 25313085, 25576919, 25645022, 25649613, 25703326, 25788265, 25813626, 25840825, 25880801, 25970228, 26252736, 26277545, 26715276, 26926077, 27283076, 27323830, 27340866, 27385486, 27683215, 27856534, 27911861, 28035139, 28049773, 28259998, 28356960, 28414323, 28454440, 28511909, 28515149, 28630053, 28688274, 28753677, 28858851, 28978113, 28994333, 29081778, 29127353, 29162853, 29185365, 29207616, 29277786, 29344170, 29393401, 29408265, 29440169, 29468140, 29477380, 29514980, 29533781, 29540198, 29541204, 29552193, 29641204, 29657328, 29687791, 29713182, 29752805, 29775756, 29797241, 29844464, 29914894, 30087897, 30105813, 30155759, 30160042, 30216369, 30297868, 30323675, 30500994, 30735509, 30878825, 30996297, 31071178, 31114449, 31120964, 31135122, 31195119, 31303531, 31326556, 31343107, 31401304, 31469100, 31527446, 31570790, 31654067, 31669575, 31788038		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28415668, 30323675, 31114449		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22807066, 24898807, 25732087, 28829588, 30787272		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	36324122	Inhibit	★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12820337		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24120138, 26339369, 29440169		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	24569090, 28515149		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	30537064		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30500994, 30588012, 31652354		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25078136, 31401304		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26926996	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29462566		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	30537064		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	31638999	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26453405		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28086949, 32655719	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	40483507	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	33299887	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	33462268	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	25644089		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	25957288		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	28183315		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	28183315	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31665243		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19920251, 20336315, 20507318, 21334407, 21569526, 21700219, 21789790, 22052977, 22087286, 22236875, 22807066, 22901803, 23154538, 23267074, 23451252, 23859618, 24077665, 24120138, 24492614, 24884829, 24972138, 25070887, 25078136, 25514599, 25649613, 25661370, 25738776, 25808097, 25844669, 25880801, 25948776, 25961580, 25970228, 26082202, 26410533, 26500058, 26501265, 26739387, 26745603, 26874904, 26926077, 27323830, 27340866, 27602585, 27683215, 27810895, 27960279, 28036303, 28067230, 28236227, 28346425, 28422979, 28454440, 28489603, 28511909, 28515149, 28569774, 28641457, 28753677, 28778925, 28858851, 29050494, 29145305, 29155364, 29207616, 29229835, 29262861, 29299177, 29440169, 29449541, 29455645, 29540198, 29552193, 29695915, 29736561, 29752805, 29775756, 29925919, 30009856, 30018720, 30072740, 30087897, 30140938, 30155759, 30221356, 30249877, 30257387, 30257458, 30266938, 30728290, 30756445, 30906218, 30911983, 30925904, 30989436, 30996297, 31000383, 31054406, 31120964, 31246990, 31326556, 31469100, 31501520, 31521887, 31527446, 31632565, 31654067, 3496928		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	BEFREE	29104286		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26683771, 34847775	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29462566		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25233397, 25444918, 25649613, 27593857, 27683215, 29931766, 31106485, 31120964		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29462566, 30455376		★☆☆☆☆ Found in Text Mining only
Nonspherocytic hemolytic anemia	Hemolytic Anemia	BEFREE	15870173		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25471892, 29104286		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25471892	Stimulate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29782350, 29925919		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27644251, 29050494	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28393220, 29155364, 29499942		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	28281967, 28346425		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25964202, 28753677, 29277786, 29558748, 29752805		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28281967, 29866066, 34131394, 34510316, 38583177	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29752805	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25411978, 26112218, 26739387, 27911861, 28569774, 29374159, 29540198, 31527446, 31689601		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26500118, 29335522, 29434927		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	26739387		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23508580, 24561986, 25197966, 26989901, 29374159, 34110962, 34660806, 35752173, 37277450	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23846818		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28922168	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria type 1	Hyperoxaluria	Pubtator	22999886	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24884829, 27696457, 28994148, 29094170, 29736561, 30072740, 30216369, 31135122, 31548301		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24859886, 28994148, 30216369, 30817743, 31135122, 31500219, 31902674, 33722248, 35242214, 35584006	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31717694, 31814765		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26876154, 29882248, 30160042, 30745848		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	31076418		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	26092770	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29552193		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27779186, 30222136		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	29636835		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	22580449		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	24058603		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	24058603	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18464261		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25970228, 27683215, 30257458, 30333907		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25064730, 25808097, 26404132, 28818096, 29916308, 30756445, 31004604		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34290225, 35054968, 39456901	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29312802		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28978113, 29340090		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30455376, 31411894		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22627140, 22912555, 26745603, 28235245, 28588255, 29032577, 29541204, 29997453, 30417413, 31000383		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22912555, 23840737, 26464675, 26745603, 27696637, 28235245, 35000669, 35196650, 37624791	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	38067435	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36897686	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25880801, 30018720, 31669575		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25880801, 30018720, 31669575		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25880801, 30768848, 36851875, 37864896	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	25880801	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25703326, 28398453, 31564074		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26715276, 31372790, 31564074, 38171333	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36099094	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29273328, 30996297		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25266796, 30249877, 31246990, 32073734, 33991457, 37815895	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28378811, 30443191	Stimulate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	29695915		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	26989901	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27492148, 31465717	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27916907, 28446743, 33800513, 36705569	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	25778902		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	26092770	Associate	★☆☆☆☆ Found in Text Mining only