PITX3 (paired like homeodomain 3)

Gene

• Entrez ID: 5309
• Gene name: Paired like homeodomain 3
• Gene symbol: PITX3
• Synonyms (NCBI Gene): ASGD1, ASMD, ASOD, CTPP4, CTRCT11, PTX3
• Chromosome: 10
• Chromosome location: 10q24.32
• Summary: This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. This protein is involved in lens formation during eye development. Mutations of this ge

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894175	C>T	Pathogenic	Missense variant, coding sequence variant
rs1057518058	G>A	Likely-pathogenic	Stop gained, coding sequence variant
rs1411557416	CAGGGCCCCAGGCCCTG>-,CAGGGCCCCAGGCCCTGCAGGGCCCCAGGCCCTG	Uncertain-significance, pathogenic	Coding sequence variant, frameshift variant
rs1564991147	G>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1564991256	C>-	Pathogenic	Frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002354	hsa-miR-133b	FACS, Luciferase reporter assay	17761882
MIRT002354	hsa-miR-133b	FACS, Luciferase reporter assay	17761882
MIRT512885	hsa-miR-3662	PAR-CLIP	23446348
MIRT512884	hsa-miR-4676-5p	PAR-CLIP	23446348
MIRT512883	hsa-miR-575	PAR-CLIP	23446348
MIRT512882	hsa-miR-8063	PAR-CLIP	23446348
MIRT512881	hsa-miR-4698	PAR-CLIP	23446348
MIRT512880	hsa-miR-3180	PAR-CLIP	23446348
MIRT512879	hsa-miR-3180-3p	PAR-CLIP	23446348
MIRT512878	hsa-miR-3196	PAR-CLIP	23446348
MIRT512877	hsa-miR-6816-5p	PAR-CLIP	23446348
MIRT512885	hsa-miR-3662	PAR-CLIP	23446348
MIRT512884	hsa-miR-4676-5p	PAR-CLIP	23446348
MIRT512883	hsa-miR-575	PAR-CLIP	23446348
MIRT512882	hsa-miR-8063	PAR-CLIP	23446348
MIRT512881	hsa-miR-4698	PAR-CLIP	23446348
MIRT512880	hsa-miR-3180	PAR-CLIP	23446348
MIRT512879	hsa-miR-3180-3p	PAR-CLIP	23446348
MIRT512878	hsa-miR-3196	PAR-CLIP	23446348
MIRT512877	hsa-miR-6816-5p	PAR-CLIP	23446348

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0002088	Process	Lens development in camera-type eye	IEA
GO:0002088	Process	Lens development in camera-type eye	ISS
GO:0002089	Process	Lens morphogenesis in camera-type eye	IEA
GO:0002089	Process	Lens morphogenesis in camera-type eye	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007626	Process	Locomotory behavior	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0009887	Process	Animal organ morphogenesis	TAS	9620774
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014014	Process	Negative regulation of gliogenesis	IEA
GO:0030901	Process	Midbrain development	IEA
GO:0030901	Process	Midbrain development	ISS
GO:0035902	Process	Response to immobilization stress	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048666	Process	Neuron development	IEA
GO:0050768	Process	Negative regulation of neurogenesis	IEA
GO:0070306	Process	Lens fiber cell differentiation	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	ISS
GO:0071542	Process	Dopaminergic neuron differentiation	TAS	24431302
GO:1904313	Process	Response to methamphetamine hydrochloride	IEA
GO:1904935	Process	Positive regulation of cell proliferation in midbrain	IEA
GO:1990792	Process	Cellular response to glial cell derived neurotrophic factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 602669
• HGNC: 9006
• e!Ensembl: ENSG00000107859

Protein

• UniProt ID: O75364
• Protein name: Pituitary homeobox 3 (Homeobox protein PITX3) (Paired-like homeodomain transcription factor 3)
• Protein function: Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. In addition to its importance during development, it also has roles in the long-term surviv
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	63 → 119	Homeodomain	Domain
  PF03826	OAR	258 → 275	OAR motif	Motif

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in developing eye lens.
• Sequence:

  MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKK
  KQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKR
  ERSQQAELCKGSFAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVG
  PLASQPVFSPPSSIAASMVPSAAAAPGTVPGPGALQGLGGGPPGLAPAAVSSGAVSCPYA
  SAAAAAAAAASSPYVYRDPCNSSLASLRLKAKQHASFSYPAVHGPPPAANLSPCQYAVER
  PV

• Sequence length: 302

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Anterior segment dysgenesis 1	Pathogenic; Likely pathogenic	rs1411557416	RCV005869604 RCV004787888	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ANTERIOR SEGMENT DYSGENESIS 1, MULTIPLE SUBTYPES	Pathogenic	rs1411557416	RCV002294347	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cataract 11 multiple types	Likely pathogenic; Pathogenic	rs104894175, rs1411557416	RCV000007351 RCV003333078 RCV004559169	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cataract 11, posterior polar	Pathogenic	rs1564991256, rs1411557416	RCV000043531 RCV002294346	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cataract 11, posterior polar, with microphthalmia and neurodevelopmental abnormalities	Pathogenic	rs1564991256	RCV000043534	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Developmental cataract	Likely pathogenic	rs2133794292	RCV001775012	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PITX3-related disorder	Pathogenic; Likely pathogenic	rs1411557416, rs1564991147	RCV004755963 RCV004731029	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANHEDONIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR SEGMENT DYSGENESIS 1, MULTIPLE SUBTYPE S	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR SEGMENT MESENCHYMAL DYSGENESIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT 11 MULTIPLE TYPE S	—	ClinVar, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT 11, MULTIPLE TYPE S	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT GLAUCOMA SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT, AUTOSOMAL DOMINANT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT, POSTERIOR POLAR, 4	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT-GLAUCOMA SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CATARACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CATARACT-ANTERIOR SEGMENT DYSGENESIS SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET POSTERIOR POLAR CATARACT	—	ClinVar, Orphanet ClinVar, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROPHTHALMOS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POSTERIOR SUBCAPSULAR CATARACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal involuntary movement	Abnormal Involuntary Movement	BEFREE	30030752		★☆☆☆☆ Found in Text Mining only
Akinesia	Akinesia	BEFREE	12702666		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22632920		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	PSYGENET_DG	24480473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR SEGMENT DYSGENESIS 1	Segment dysgenesis	GENOMICS_ENGLAND_DG	15286169, 20033184		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ANTERIOR SEGMENT DYSGENESIS 1	Segment dysgenesis	CLINVAR_DG	17888164, 24555714		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Anterior segment mesenchymal dysgenesis	Anterior segment dysgenesis	BEFREE	15665340, 16565358, 18989383, 22223473, 9620774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior segment mesenchymal dysgenesis	Anterior segment mesenchymal dysgenesis	Pubtator	15665340, 18989383, 20376326, 21836522, 24555714, 36153513	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior segment mesenchymal dysgenesis	Anterior segment dysgenesis	CTD_human_DG	18989383, 9620774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior segment mesenchymal dysgenesis	Anterior segment dysgenesis	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	23573312		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23573312		★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	24555714		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	24555714		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	24555714		★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	18989383	Associate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	28526615		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19153192	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	19153192	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	12660863, 16272057, 16565358, 16636655, 18989383, 24555714, 29314435, 30816539, 9620774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	CTD_human_DG	16565358, 9620774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	Pubtator	16636655, 18989383, 20376326, 24555714, 30816539, 30894134, 33923544, 34345029, 36153513, 36161833	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	LHGDN	17888164		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract Autosomal Dominant	Congenital cataract	Pubtator	24555714, 30816539, 34345029	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, AUTOSOMAL DOMINANT	Cataract	GENOMICS_ENGLAND_DG	15286169		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT, POSTERIOR POLAR, 4 (disorder)	Cataract	CTD_human_DG	15286169		★☆☆☆☆ Found in Text Mining only
CATARACT, POSTERIOR POLAR, 4 (disorder)	Cataract	UNIPROT_DG	15286169, 9620774		★☆☆☆☆ Found in Text Mining only
CATARACT, POSTERIOR POLAR, 4 (disorder)	Cataract	GENOMICS_ENGLAND_DG	15286169, 20033184		★☆☆☆☆ Found in Text Mining only
CATARACT, POSTERIOR POLAR, 4 (disorder)	Cataract	CLINVAR_DG	17888164, 24555714		★☆☆☆☆ Found in Text Mining only
Cataract, Posterior Polar, 4, With Microphthalmia And Neurodevelopmental Abnormalities	Cataract With Microphthalmia And Neurodevelopmental Abnormalities	CTD_human_DG	15286169		★☆☆☆☆ Found in Text Mining only
Cataract-glaucoma syndrome	Cataract-glaucoma syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30572222		★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	17888164		★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	16636655, 17888164, 20376326, 24555714, 29405783, 30816539, 30894134, 9620774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	31105751		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal disease	Pubtator	36153513	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Opacity	Corneal opacity	Pubtator	15665340	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28991698		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	24480473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disorder of eye	Disorder Of Eye	GENOMICS_ENGLAND_DG	20033184		★☆☆☆☆ Found in Text Mining only
Early-onset posterior polar cataract	Cataract	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erectile dysfunction	Erectile Dysfunction	BEFREE	29681053		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	27145793		★☆☆☆☆ Found in Text Mining only
Eye Abnormalities	Eye abnormalities	Pubtator	15912477, 21836522	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31105751		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	30952879		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30952879		★☆☆☆☆ Found in Text Mining only
Hydrophthalmos	Hydrophthalmos	Pubtator	36153513	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22223473		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	20376326		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	20376326	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Irido-corneal dysgenesis	Anterior segment dysgenesis	BEFREE	21836522, 23527636, 24555714		★☆☆☆☆ Found in Text Mining only
Irido-corneo-trabecular dysgenesis (disorder)	Anterior segment dysgenesis	BEFREE	29405783		★☆☆☆☆ Found in Text Mining only
Irido-corneo-trabecular dysgenesis (disorder)	Anterior segment dysgenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	27415467		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23573312		★☆☆☆☆ Found in Text Mining only
Mental impairment	Mental Depression	BEFREE	22223473		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	20376326		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31560233		★☆☆☆☆ Found in Text Mining only
Microcornea	Microcornea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	16565358, 17888164, 21836522, 22223473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microphthalmos	Microphthalmos	CTD_human_DG	16565358		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microphthalmos	Microphthalmos	Pubtator	21836522, 36153513	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microphthalmos	Microphthalmos	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	28216633		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	26593886		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18049867		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27831642		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28298172		★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11724911, 12702666, 17905480, 18049867, 18420308, 19345444, 19394114, 19754401, 20468068, 21138504, 21469209, 21524731, 21565251, 22037506, 22309633, 22411443, 22429667, 24394914, 24525476, 27514757, 27977132, 28883785, 28991698, 30104963, 31310388		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	22411443	Associate	★☆☆☆☆ Found in Text Mining only
Polar cataract	Cataract	BEFREE	21633712		★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	ORPHANET_DG	16636655, 21633712		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Posterior subcapsular cataract	Capsular cataract	BEFREE	30894134		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Presenile dementia	Senile Dementia	BEFREE	28991698		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	27415467		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27708722	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudoaphakia	Cataract	CTD_human_DG	16565358, 9620774		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20570600, 26593886		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20570600		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	28793880		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28960823		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28174607	Associate	★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	18989383	Associate	★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	18420308		★☆☆☆☆ Found in Text Mining only