Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5295
Gene name	Phosphoinositide-3-kinase regulatory subunit 1
Gene symbol	PIK3R1
Synonyms (NCBI Gene)	AGM7GRB1IMD36p85p85-ALPHAp85alpha
Chromosome	5
Chromosome location	5q13.1
Summary	Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory sub

Show/Hide all (33)

SNP ID	Visualize variation	Clinical significance	Consequence
rs149905863	A>C,G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs397509384	G>A	Pathogenic	Genic upstream transcript variant, coding sequence variant, stop gained
rs397514046	ATT>-	Pathogenic, uncertain-significance	Coding sequence variant, inframe deletion
rs397514047	G>A	Pathogenic	Coding sequence variant, missense variant
rs397515453	C>T	Pathogenic	Coding sequence variant, missense variant
rs398122384	->T	Pathogenic	Frameshift variant, coding sequence variant
rs398122385	->C	Pathogenic	Frameshift variant, coding sequence variant
rs515726149	G>A	Pathogenic	Coding sequence variant, missense variant
rs515726150	AA>-	Pathogenic	Frameshift variant, coding sequence variant
rs515726151	T>G	Pathogenic	Coding sequence variant, stop gained
rs587777709	G>A,C,T	Pathogenic, likely-pathogenic	Splice donor variant
rs587784325	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs773686816	C>A,G,T	Likely-pathogenic	Coding sequence variant, synonymous variant, missense variant
rs780724594	T>C	Likely-pathogenic	Splice donor variant
rs797045063	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519757	G>A,C	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519838	C>T	Likely-pathogenic, pathogenic	Stop gained, coding sequence variant
rs1057519839	G>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519840	GACAAACGTATGAACAGC>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs1057519841	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519842	CGA>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs1057520690	C>T	Pathogenic	5 prime UTR variant, coding sequence variant, stop gained
rs1131692242	AGA>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs1131692243	GGT>-	Likely-pathogenic	Splice acceptor variant, coding sequence variant
rs1403833564	A>G	Likely-pathogenic	Splice acceptor variant
rs1554051033	G>C	Pathogenic	Splice acceptor variant
rs1554051067	TG>-	Pathogenic	Intron variant, splice donor variant
rs1554051075	T>A,G	Pathogenic	Splice donor variant
rs1554051161	G>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1554051268	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1561299903	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1580260232	T>-	Pathogenic	Frameshift variant, upstream transcript variant, coding sequence variant, genic upstream transcript variant
rs1580262965	CCAGG>-	Pathogenic	Splice donor variant, coding sequence variant

1618

Show/Hide all (1618)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004103	hsa-miR-29a-3p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	20943204
MIRT004103	hsa-miR-29a-3p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	20943204
MIRT006724	hsa-miR-376a-3p	Luciferase reporter assayqRT-PCRWestern blot	22684007
MIRT006724	hsa-miR-376a-3p	Luciferase reporter assayqRT-PCRWestern blot	22684007
MIRT030860	hsa-miR-21-5p	Microarray	18591254
MIRT052505	hsa-let-7a-5p	CLASH	23622248
MIRT053013	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	22609116
MIRT054427	hsa-miR-503-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	24550137
MIRT054427	hsa-miR-503-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	24550137
MIRT027237	hsa-miR-29b-3p	Western blot	24147037
MIRT438233	hsa-miR-221-3p	Western blot	24147037
MIRT027237	hsa-miR-29b-3p	Western blot	24147037
MIRT438233	hsa-miR-221-3p	Western blot	24147037
MIRT314098	hsa-miR-107	HITS-CLIP	21572407
MIRT314097	hsa-miR-103a-3p	HITS-CLIP	21572407
MIRT314055	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT314051	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT314053	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT314059	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT314056	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT314054	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT314052	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT054427	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT314057	hsa-miR-646	HITS-CLIP	21572407
MIRT314100	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT314102	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT521894	hsa-miR-8485	HITS-CLIP	21572407
MIRT521893	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT521892	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT521891	hsa-miR-603	HITS-CLIP	21572407
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT510971	hsa-miR-4643	HITS-CLIP	21572407
MIRT510970	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT510969	hsa-miR-455-5p	HITS-CLIP	21572407
MIRT521890	hsa-miR-3941	HITS-CLIP	21572407
MIRT510968	hsa-miR-466	HITS-CLIP	21572407
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510966	hsa-miR-3924	HITS-CLIP	21572407
MIRT314070	hsa-miR-448	HITS-CLIP	21572407
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT314098	hsa-miR-107	HITS-CLIP	21572407
MIRT314097	hsa-miR-103a-3p	HITS-CLIP	21572407
MIRT314055	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT314051	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT314053	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT314059	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT314056	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT314054	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT314052	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT054427	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT314057	hsa-miR-646	HITS-CLIP	21572407
MIRT506175	hsa-miR-4793-5p	HITS-CLIP	21572407
MIRT506174	hsa-miR-939-3p	HITS-CLIP	21572407
MIRT506173	hsa-miR-6852-5p	HITS-CLIP	21572407
MIRT506172	hsa-miR-6742-3p	HITS-CLIP	21572407
MIRT314100	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT314102	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT506171	hsa-miR-1343-3p	HITS-CLIP	21572407
MIRT506170	hsa-miR-6783-3p	HITS-CLIP	21572407
MIRT521894	hsa-miR-8485	HITS-CLIP	21572407
MIRT521893	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT521892	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT521891	hsa-miR-603	HITS-CLIP	21572407
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT521890	hsa-miR-3941	HITS-CLIP	21572407
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT521894	hsa-miR-8485	HITS-CLIP	23313552
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT521891	hsa-miR-603	HITS-CLIP	23313552
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT521890	hsa-miR-3941	HITS-CLIP	23313552
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23313552
MIRT314098	hsa-miR-107	HITS-CLIP	23313552
MIRT314097	hsa-miR-103a-3p	HITS-CLIP	23313552
MIRT314055	hsa-miR-424-5p	HITS-CLIP	23313552
MIRT314051	hsa-miR-15a-5p	HITS-CLIP	23313552
MIRT314053	hsa-miR-15b-5p	HITS-CLIP	23313552
MIRT314059	hsa-miR-6838-5p	HITS-CLIP	23313552
MIRT314056	hsa-miR-497-5p	HITS-CLIP	23313552
MIRT314054	hsa-miR-195-5p	HITS-CLIP	23313552
MIRT314052	hsa-miR-16-5p	HITS-CLIP	23313552
MIRT054427	hsa-miR-503-5p	HITS-CLIP	23313552
MIRT314057	hsa-miR-646	HITS-CLIP	23313552
MIRT314100	hsa-miR-4524a-5p	HITS-CLIP	23313552
MIRT314102	hsa-miR-4524b-5p	HITS-CLIP	23313552
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT314055	hsa-miR-424-5p	HITS-CLIP	23824327
MIRT314051	hsa-miR-15a-5p	HITS-CLIP	23824327
MIRT314053	hsa-miR-15b-5p	HITS-CLIP	23824327
MIRT314059	hsa-miR-6838-5p	HITS-CLIP	23824327
MIRT314056	hsa-miR-497-5p	HITS-CLIP	23824327
MIRT314054	hsa-miR-195-5p	HITS-CLIP	23824327
MIRT314052	hsa-miR-16-5p	HITS-CLIP	23824327
MIRT054427	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT314057	hsa-miR-646	HITS-CLIP	23824327
MIRT314100	hsa-miR-4524a-5p	HITS-CLIP	23824327
MIRT314102	hsa-miR-4524b-5p	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT314098	hsa-miR-107	HITS-CLIP	23824327
MIRT314097	hsa-miR-103a-3p	HITS-CLIP	23824327
MIRT314055	hsa-miR-424-5p	HITS-CLIP	23824327
MIRT314051	hsa-miR-15a-5p	HITS-CLIP	23824327
MIRT314053	hsa-miR-15b-5p	HITS-CLIP	23824327
MIRT314059	hsa-miR-6838-5p	HITS-CLIP	23824327
MIRT314056	hsa-miR-497-5p	HITS-CLIP	23824327
MIRT314054	hsa-miR-195-5p	HITS-CLIP	23824327
MIRT314052	hsa-miR-16-5p	HITS-CLIP	23824327
MIRT054427	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314057	hsa-miR-646	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT314100	hsa-miR-4524a-5p	HITS-CLIP	23824327
MIRT314102	hsa-miR-4524b-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT314098	hsa-miR-107	PAR-CLIP	21572407
MIRT314097	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT314055	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT314051	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT314053	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT314059	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT314056	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT314054	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT314052	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT054427	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT314057	hsa-miR-646	PAR-CLIP	21572407
MIRT506175	hsa-miR-4793-5p	PAR-CLIP	21572407
MIRT506174	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT506173	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT506172	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT555608	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT555607	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT555606	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT555605	hsa-miR-612	PAR-CLIP	21572407
MIRT555604	hsa-miR-6860	PAR-CLIP	21572407
MIRT555603	hsa-miR-6721-5p	PAR-CLIP	21572407
MIRT314100	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT314102	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT506171	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT506170	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT314070	hsa-miR-448	PAR-CLIP	21572407
MIRT521894	hsa-miR-8485	PAR-CLIP	21572407
MIRT521893	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT521892	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT521891	hsa-miR-603	PAR-CLIP	21572407
MIRT510972	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT510971	hsa-miR-4643	PAR-CLIP	21572407
MIRT510970	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT314101	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT510969	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT521890	hsa-miR-3941	PAR-CLIP	21572407
MIRT510968	hsa-miR-466	PAR-CLIP	21572407
MIRT510967	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT314099	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510966	hsa-miR-3924	PAR-CLIP	21572407
MIRT506169	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT314098	hsa-miR-107	PAR-CLIP	21572407
MIRT314097	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT314055	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT314051	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT314053	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT314059	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT314056	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT314054	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT314052	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT054427	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT521894	hsa-miR-8485	PAR-CLIP	21572407
MIRT510972	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT314057	hsa-miR-646	PAR-CLIP	21572407
MIRT314101	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT506175	hsa-miR-4793-5p	PAR-CLIP	21572407
MIRT506174	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT506173	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT506172	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT314100	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT314102	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT314099	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506171	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT506170	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT506169	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT314098	hsa-miR-107	PAR-CLIP	23446348
MIRT314097	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT314055	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT314051	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT314053	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT314059	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT314056	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT314054	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT314052	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT054427	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT314057	hsa-miR-646	PAR-CLIP	23446348
MIRT506175	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT506174	hsa-miR-939-3p	PAR-CLIP	23446348
MIRT506173	hsa-miR-6852-5p	PAR-CLIP	23446348
MIRT506172	hsa-miR-6742-3p	PAR-CLIP	23446348
MIRT314100	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT314102	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT506171	hsa-miR-1343-3p	PAR-CLIP	23446348
MIRT506170	hsa-miR-6783-3p	PAR-CLIP	23446348
MIRT521894	hsa-miR-8485	PAR-CLIP	23446348
MIRT521893	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT521892	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT521891	hsa-miR-603	PAR-CLIP	23446348
MIRT510972	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT510971	hsa-miR-4643	PAR-CLIP	23446348
MIRT510970	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT314101	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510969	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT521890	hsa-miR-3941	PAR-CLIP	23446348
MIRT510968	hsa-miR-466	PAR-CLIP	23446348
MIRT510967	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT314099	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510966	hsa-miR-3924	PAR-CLIP	23446348
MIRT314070	hsa-miR-448	PAR-CLIP	23446348
MIRT506169	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT314098	hsa-miR-107	PAR-CLIP	23446348
MIRT314097	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT314055	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT314051	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT314053	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT314059	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT314056	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT314054	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT314052	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT054427	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT314057	hsa-miR-646	PAR-CLIP	23446348
MIRT506175	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT506174	hsa-miR-939-3p	PAR-CLIP	23446348
MIRT506173	hsa-miR-6852-5p	PAR-CLIP	23446348
MIRT506172	hsa-miR-6742-3p	PAR-CLIP	23446348
MIRT314100	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT314102	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT506171	hsa-miR-1343-3p	PAR-CLIP	23446348
MIRT506170	hsa-miR-6783-3p	PAR-CLIP	23446348
MIRT510972	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT510971	hsa-miR-4643	PAR-CLIP	23446348
MIRT510970	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT314101	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510969	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT510968	hsa-miR-466	PAR-CLIP	23446348
MIRT510967	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT314099	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510966	hsa-miR-3924	PAR-CLIP	23446348
MIRT314070	hsa-miR-448	PAR-CLIP	23446348
MIRT506169	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT314098	hsa-miR-107	PAR-CLIP	23446348
MIRT314097	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT314055	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT314051	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT314053	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT314059	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT314056	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT314054	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT314052	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT054427	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT314057	hsa-miR-646	PAR-CLIP	23446348
MIRT314101	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506175	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT506174	hsa-miR-939-3p	PAR-CLIP	23446348
MIRT506173	hsa-miR-6852-5p	PAR-CLIP	23446348
MIRT506172	hsa-miR-6742-3p	PAR-CLIP	23446348
MIRT314100	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT314102	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT314099	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506171	hsa-miR-1343-3p	PAR-CLIP	23446348
MIRT506170	hsa-miR-6783-3p	PAR-CLIP	23446348
MIRT506169	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT732229	hsa-miR-542-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	26286747
MIRT732229	hsa-miR-542-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	26286747
MIRT732229	hsa-miR-542-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	26286747
MIRT732229	hsa-miR-542-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	26286747
MIRT438233	hsa-miR-221-3p	MicroarrayNext Generation Sequencing (NGS)qRT-PCR	25236949
MIRT030860	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	26676464
MIRT030860	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	26676464
MIRT030860	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	26676464
MIRT030860	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	26676464
MIRT027237	hsa-miR-29b-3p	FlowLuciferase reporter assayqRT-PCRWestern blotChIP-PCR	25356754
MIRT027237	hsa-miR-29b-3p	FlowLuciferase reporter assayqRT-PCRWestern blotChIP-PCR	25356754
MIRT755859	hsa-miR-486-5p	Luciferase reporter assayNext Generation Sequencing (NGS)qRT-PCRWestern blot	25475121
MIRT755859	hsa-miR-486-5p	Luciferase reporter assayNext Generation Sequencing (NGS)qRT-PCRWestern blot	25475121
MIRT314097	hsa-miR-103a-3p	qRT-PCR	34184078
MIRT734969	hsa-miR-100-3p	Luciferase reporter assayWestern blottingqRT-PCR	33221758
MIRT314052	hsa-miR-16-5p	Western blottingqRT-PCR	32125337
MIRT735650	hsa-miR-144-3p	RNA-seqFlow cytometry	32026263
MIRT735977	hsa-miR-199a-3p	Western blottingqRT-PCR	31789347
MIRT736666	hsa-miR-96-5p	Luciferase reporter assayWestern blottingqRT-PCR	32968049
MIRT737411	hsa-miR-17-5p	Luciferase reporter assayWestern blottingRNA-seqqRT-PCR	31938022
MIRT314098	hsa-miR-107	HITS-CLIP	21572407
MIRT314097	hsa-miR-103a-3p	HITS-CLIP	21572407
MIRT314055	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT314051	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT314053	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT314059	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT314056	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT314054	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT314052	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT054427	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT314057	hsa-miR-646	HITS-CLIP	21572407
MIRT314100	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT314102	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT521894	hsa-miR-8485	HITS-CLIP	21572407
MIRT521893	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT521892	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT521891	hsa-miR-603	HITS-CLIP	21572407
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT510971	hsa-miR-4643	HITS-CLIP	21572407
MIRT510970	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT510969	hsa-miR-455-5p	HITS-CLIP	21572407
MIRT521890	hsa-miR-3941	HITS-CLIP	21572407
MIRT510968	hsa-miR-466	HITS-CLIP	21572407
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510966	hsa-miR-3924	HITS-CLIP	21572407
MIRT314070	hsa-miR-448	HITS-CLIP	21572407
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT314098	hsa-miR-107	HITS-CLIP	21572407
MIRT314097	hsa-miR-103a-3p	HITS-CLIP	21572407
MIRT314055	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT314051	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT314053	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT314059	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT314056	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT314054	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT314052	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT054427	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT314057	hsa-miR-646	HITS-CLIP	21572407
MIRT506175	hsa-miR-4793-5p	HITS-CLIP	21572407
MIRT506174	hsa-miR-939-3p	HITS-CLIP	21572407
MIRT506173	hsa-miR-6852-5p	HITS-CLIP	21572407
MIRT506172	hsa-miR-6742-3p	HITS-CLIP	21572407
MIRT314100	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT314102	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT506171	hsa-miR-1343-3p	HITS-CLIP	21572407
MIRT506170	hsa-miR-6783-3p	HITS-CLIP	21572407
MIRT521894	hsa-miR-8485	HITS-CLIP	21572407
MIRT521893	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT521892	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT521891	hsa-miR-603	HITS-CLIP	21572407
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT521890	hsa-miR-3941	HITS-CLIP	21572407
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT521894	hsa-miR-8485	HITS-CLIP	23313552
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT521891	hsa-miR-603	HITS-CLIP	23313552
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT521890	hsa-miR-3941	HITS-CLIP	23313552
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23313552
MIRT314098	hsa-miR-107	HITS-CLIP	23313552
MIRT314097	hsa-miR-103a-3p	HITS-CLIP	23313552
MIRT314055	hsa-miR-424-5p	HITS-CLIP	23313552
MIRT314051	hsa-miR-15a-5p	HITS-CLIP	23313552
MIRT314053	hsa-miR-15b-5p	HITS-CLIP	23313552
MIRT314059	hsa-miR-6838-5p	HITS-CLIP	23313552
MIRT314056	hsa-miR-497-5p	HITS-CLIP	23313552
MIRT314054	hsa-miR-195-5p	HITS-CLIP	23313552
MIRT314052	hsa-miR-16-5p	HITS-CLIP	23313552
MIRT054427	hsa-miR-503-5p	HITS-CLIP	23313552
MIRT314057	hsa-miR-646	HITS-CLIP	23313552
MIRT314100	hsa-miR-4524a-5p	HITS-CLIP	23313552
MIRT314102	hsa-miR-4524b-5p	HITS-CLIP	23313552
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT314055	hsa-miR-424-5p	HITS-CLIP	23824327
MIRT314051	hsa-miR-15a-5p	HITS-CLIP	23824327
MIRT314053	hsa-miR-15b-5p	HITS-CLIP	23824327
MIRT314059	hsa-miR-6838-5p	HITS-CLIP	23824327
MIRT314056	hsa-miR-497-5p	HITS-CLIP	23824327
MIRT314054	hsa-miR-195-5p	HITS-CLIP	23824327
MIRT314052	hsa-miR-16-5p	HITS-CLIP	23824327
MIRT054427	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT314057	hsa-miR-646	HITS-CLIP	23824327
MIRT314100	hsa-miR-4524a-5p	HITS-CLIP	23824327
MIRT314102	hsa-miR-4524b-5p	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT510967	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT521893	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT521892	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT521891	hsa-miR-603	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521890	hsa-miR-3941	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT314098	hsa-miR-107	HITS-CLIP	23824327
MIRT314097	hsa-miR-103a-3p	HITS-CLIP	23824327
MIRT314055	hsa-miR-424-5p	HITS-CLIP	23824327
MIRT314051	hsa-miR-15a-5p	HITS-CLIP	23824327
MIRT314053	hsa-miR-15b-5p	HITS-CLIP	23824327
MIRT314059	hsa-miR-6838-5p	HITS-CLIP	23824327
MIRT314056	hsa-miR-497-5p	HITS-CLIP	23824327
MIRT314054	hsa-miR-195-5p	HITS-CLIP	23824327
MIRT314052	hsa-miR-16-5p	HITS-CLIP	23824327
MIRT054427	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314057	hsa-miR-646	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT314100	hsa-miR-4524a-5p	HITS-CLIP	23824327
MIRT314102	hsa-miR-4524b-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521894	hsa-miR-8485	HITS-CLIP	23824327
MIRT510972	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT314101	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT314099	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT506169	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT314098	hsa-miR-107	PAR-CLIP	21572407
MIRT314097	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT314055	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT314051	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT314053	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT314059	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT314056	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT314054	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT314052	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT054427	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT314057	hsa-miR-646	PAR-CLIP	21572407
MIRT506175	hsa-miR-4793-5p	PAR-CLIP	21572407
MIRT506174	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT506173	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT506172	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT555608	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT555607	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT555606	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT555605	hsa-miR-612	PAR-CLIP	21572407
MIRT555604	hsa-miR-6860	PAR-CLIP	21572407
MIRT555603	hsa-miR-6721-5p	PAR-CLIP	21572407
MIRT314100	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT314102	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT506171	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT506170	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT314070	hsa-miR-448	PAR-CLIP	21572407
MIRT521894	hsa-miR-8485	PAR-CLIP	21572407
MIRT521893	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT521892	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT521891	hsa-miR-603	PAR-CLIP	21572407
MIRT510972	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT510971	hsa-miR-4643	PAR-CLIP	21572407
MIRT510970	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT314101	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT510969	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT521890	hsa-miR-3941	PAR-CLIP	21572407
MIRT510968	hsa-miR-466	PAR-CLIP	21572407
MIRT510967	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT314099	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510966	hsa-miR-3924	PAR-CLIP	21572407
MIRT506169	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT314098	hsa-miR-107	PAR-CLIP	21572407
MIRT314097	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT314055	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT314051	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT314053	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT314059	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT314056	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT314054	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT314052	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT054427	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT521894	hsa-miR-8485	PAR-CLIP	21572407
MIRT510972	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT314057	hsa-miR-646	PAR-CLIP	21572407
MIRT314101	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT506175	hsa-miR-4793-5p	PAR-CLIP	21572407
MIRT506174	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT506173	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT506172	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT314100	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT314102	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT314099	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506171	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT506170	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT506169	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT314098	hsa-miR-107	PAR-CLIP	23446348
MIRT314097	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT314055	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT314051	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT314053	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT314059	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT314056	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT314054	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT314052	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT054427	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT314057	hsa-miR-646	PAR-CLIP	23446348
MIRT506175	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT506174	hsa-miR-939-3p	PAR-CLIP	23446348
MIRT506173	hsa-miR-6852-5p	PAR-CLIP	23446348
MIRT506172	hsa-miR-6742-3p	PAR-CLIP	23446348
MIRT314100	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT314102	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT506171	hsa-miR-1343-3p	PAR-CLIP	23446348
MIRT506170	hsa-miR-6783-3p	PAR-CLIP	23446348
MIRT521894	hsa-miR-8485	PAR-CLIP	23446348
MIRT521893	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT521892	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT521891	hsa-miR-603	PAR-CLIP	23446348
MIRT510972	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT510971	hsa-miR-4643	PAR-CLIP	23446348
MIRT510970	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT314101	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510969	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT521890	hsa-miR-3941	PAR-CLIP	23446348
MIRT510968	hsa-miR-466	PAR-CLIP	23446348
MIRT510967	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT314099	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510966	hsa-miR-3924	PAR-CLIP	23446348
MIRT314070	hsa-miR-448	PAR-CLIP	23446348
MIRT506169	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT314098	hsa-miR-107	PAR-CLIP	23446348
MIRT314097	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT314055	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT314051	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT314053	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT314059	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT314056	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT314054	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT314052	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT054427	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT314057	hsa-miR-646	PAR-CLIP	23446348
MIRT506175	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT506174	hsa-miR-939-3p	PAR-CLIP	23446348
MIRT506173	hsa-miR-6852-5p	PAR-CLIP	23446348
MIRT506172	hsa-miR-6742-3p	PAR-CLIP	23446348
MIRT314100	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT314102	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT506171	hsa-miR-1343-3p	PAR-CLIP	23446348
MIRT506170	hsa-miR-6783-3p	PAR-CLIP	23446348
MIRT510972	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT510971	hsa-miR-4643	PAR-CLIP	23446348
MIRT510970	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT314101	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510969	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT510968	hsa-miR-466	PAR-CLIP	23446348
MIRT510967	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT314099	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510966	hsa-miR-3924	PAR-CLIP	23446348
MIRT314070	hsa-miR-448	PAR-CLIP	23446348
MIRT506169	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT314098	hsa-miR-107	PAR-CLIP	23446348
MIRT314097	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT314055	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT314051	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT314053	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT314059	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT314056	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT314054	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT314052	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT054427	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT314057	hsa-miR-646	PAR-CLIP	23446348
MIRT314101	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506175	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT506174	hsa-miR-939-3p	PAR-CLIP	23446348
MIRT506173	hsa-miR-6852-5p	PAR-CLIP	23446348
MIRT506172	hsa-miR-6742-3p	PAR-CLIP	23446348
MIRT314100	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT314102	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT314099	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506171	hsa-miR-1343-3p	PAR-CLIP	23446348
MIRT506170	hsa-miR-6783-3p	PAR-CLIP	23446348
MIRT506169	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT755859	hsa-miR-486-5p	Luciferase reporter assayWestern blottingqRT-PCR	35621142
MIRT1234283	hsa-miR-103a	CLIP-seq
MIRT1234284	hsa-miR-105	CLIP-seq
MIRT1234285	hsa-miR-1207-3p	CLIP-seq
MIRT1234286	hsa-miR-1231	CLIP-seq
MIRT1234287	hsa-miR-1233	CLIP-seq
MIRT1234288	hsa-miR-1243	CLIP-seq
MIRT1234289	hsa-miR-1245b-3p	CLIP-seq
MIRT1234290	hsa-miR-1253	CLIP-seq
MIRT1234291	hsa-miR-1256	CLIP-seq
MIRT1234292	hsa-miR-1266	CLIP-seq
MIRT1234293	hsa-miR-1267	CLIP-seq
MIRT1234294	hsa-miR-1269	CLIP-seq
MIRT1234295	hsa-miR-1269b	CLIP-seq
MIRT1234296	hsa-miR-127-5p	CLIP-seq
MIRT1234297	hsa-miR-1278	CLIP-seq
MIRT1234298	hsa-miR-1279	CLIP-seq
MIRT1234299	hsa-miR-128	CLIP-seq
MIRT1234300	hsa-miR-1285	CLIP-seq
MIRT1234301	hsa-miR-129-3p	CLIP-seq
MIRT1234302	hsa-miR-1294	CLIP-seq
MIRT1234303	hsa-miR-129-5p	CLIP-seq
MIRT1234304	hsa-miR-1301	CLIP-seq
MIRT1234305	hsa-miR-1305	CLIP-seq
MIRT1234306	hsa-miR-1343	CLIP-seq
MIRT1234307	hsa-miR-136	CLIP-seq
MIRT1234308	hsa-miR-139-3p	CLIP-seq
MIRT1234309	hsa-miR-143	CLIP-seq
MIRT1234310	hsa-miR-150	CLIP-seq
MIRT1234311	hsa-miR-15a	CLIP-seq
MIRT1234312	hsa-miR-15b	CLIP-seq
MIRT1234313	hsa-miR-16	CLIP-seq
MIRT1234314	hsa-miR-181a	CLIP-seq
MIRT1234315	hsa-miR-181b	CLIP-seq
MIRT1234316	hsa-miR-181c	CLIP-seq
MIRT1234317	hsa-miR-181d	CLIP-seq
MIRT1234318	hsa-miR-185	CLIP-seq
MIRT1234319	hsa-miR-188-5p	CLIP-seq
MIRT1234320	hsa-miR-193a-3p	CLIP-seq
MIRT1234321	hsa-miR-193b	CLIP-seq
MIRT1234322	hsa-miR-194	CLIP-seq
MIRT1234323	hsa-miR-195	CLIP-seq
MIRT1234324	hsa-miR-199a-5p	CLIP-seq
MIRT1234325	hsa-miR-199b-3p	CLIP-seq
MIRT1234326	hsa-miR-199b-5p	CLIP-seq
MIRT1234327	hsa-miR-203	CLIP-seq
MIRT1234328	hsa-miR-204	CLIP-seq
MIRT1234329	hsa-miR-2053	CLIP-seq
MIRT1234330	hsa-miR-21	CLIP-seq
MIRT1234331	hsa-miR-211	CLIP-seq
MIRT1234332	hsa-miR-2110	CLIP-seq
MIRT1234333	hsa-miR-221	CLIP-seq
MIRT1234334	hsa-miR-222	CLIP-seq
MIRT1234335	hsa-miR-223	CLIP-seq
MIRT1234336	hsa-miR-2276	CLIP-seq
MIRT1234337	hsa-miR-2355-5p	CLIP-seq
MIRT1234338	hsa-miR-23a	CLIP-seq
MIRT1234339	hsa-miR-23b	CLIP-seq
MIRT1234340	hsa-miR-23c	CLIP-seq
MIRT1234341	hsa-miR-27a	CLIP-seq
MIRT1234342	hsa-miR-27b	CLIP-seq
MIRT1234343	hsa-miR-29a	CLIP-seq
MIRT1234344	hsa-miR-29b	CLIP-seq
MIRT1234345	hsa-miR-29c	CLIP-seq
MIRT1234346	hsa-miR-3065-5p	CLIP-seq
MIRT1234347	hsa-miR-3121-5p	CLIP-seq
MIRT1234348	hsa-miR-3129-5p	CLIP-seq
MIRT1234349	hsa-miR-3140-3p	CLIP-seq
MIRT1234350	hsa-miR-3152-5p	CLIP-seq
MIRT1234351	hsa-miR-3160-5p	CLIP-seq
MIRT1234352	hsa-miR-3180-5p	CLIP-seq
MIRT1234353	hsa-miR-3182	CLIP-seq
MIRT1234354	hsa-miR-3183	CLIP-seq
MIRT1234355	hsa-miR-320a	CLIP-seq
MIRT1234356	hsa-miR-320b	CLIP-seq
MIRT1234357	hsa-miR-320c	CLIP-seq
MIRT1234358	hsa-miR-320d	CLIP-seq
MIRT1234359	hsa-miR-323b-3p	CLIP-seq
MIRT1234360	hsa-miR-329	CLIP-seq
MIRT1234361	hsa-miR-330-3p	CLIP-seq
MIRT1234362	hsa-miR-338-5p	CLIP-seq
MIRT1234363	hsa-miR-339-3p	CLIP-seq
MIRT1234364	hsa-miR-342-5p	CLIP-seq
MIRT1234365	hsa-miR-3609	CLIP-seq
MIRT1234366	hsa-miR-3611	CLIP-seq
MIRT1234367	hsa-miR-3613-3p	CLIP-seq
MIRT1234368	hsa-miR-3615	CLIP-seq
MIRT1234369	hsa-miR-361-5p	CLIP-seq
MIRT1234370	hsa-miR-3617	CLIP-seq
MIRT1234371	hsa-miR-3620	CLIP-seq
MIRT1234372	hsa-miR-3646	CLIP-seq
MIRT1234373	hsa-miR-3654	CLIP-seq
MIRT1234374	hsa-miR-3662	CLIP-seq
MIRT1234375	hsa-miR-3667-3p	CLIP-seq
MIRT1234376	hsa-miR-3679-3p	CLIP-seq
MIRT1234377	hsa-miR-3682-5p	CLIP-seq
MIRT1234378	hsa-miR-3685	CLIP-seq
MIRT1234379	hsa-miR-376c	CLIP-seq
MIRT1234380	hsa-miR-383	CLIP-seq
MIRT1234381	hsa-miR-384	CLIP-seq
MIRT1234382	hsa-miR-3910	CLIP-seq
MIRT1234383	hsa-miR-3913-3p	CLIP-seq
MIRT1234384	hsa-miR-3914	CLIP-seq
MIRT1234385	hsa-miR-3925-3p	CLIP-seq
MIRT1234386	hsa-miR-3929	CLIP-seq
MIRT1234387	hsa-miR-3942-5p	CLIP-seq
MIRT1234388	hsa-miR-3973	CLIP-seq
MIRT1234389	hsa-miR-424	CLIP-seq
MIRT1234390	hsa-miR-4255	CLIP-seq
MIRT1234391	hsa-miR-4261	CLIP-seq
MIRT1234392	hsa-miR-4262	CLIP-seq
MIRT1234393	hsa-miR-4267	CLIP-seq
MIRT1234394	hsa-miR-4271	CLIP-seq
MIRT1234395	hsa-miR-4279	CLIP-seq
MIRT1234396	hsa-miR-4286	CLIP-seq
MIRT1234397	hsa-miR-4288	CLIP-seq
MIRT1234398	hsa-miR-4299	CLIP-seq
MIRT1234399	hsa-miR-4306	CLIP-seq
MIRT1234400	hsa-miR-4312	CLIP-seq
MIRT1234401	hsa-miR-4316	CLIP-seq
MIRT1234402	hsa-miR-4419b	CLIP-seq
MIRT1234403	hsa-miR-4422	CLIP-seq
MIRT1234404	hsa-miR-4423-5p	CLIP-seq
MIRT1234405	hsa-miR-4429	CLIP-seq
MIRT1234406	hsa-miR-4456	CLIP-seq
MIRT1234407	hsa-miR-4463	CLIP-seq
MIRT1234408	hsa-miR-4474-5p	CLIP-seq
MIRT1234409	hsa-miR-4478	CLIP-seq
MIRT1234410	hsa-miR-4481	CLIP-seq
MIRT1234411	hsa-miR-4484	CLIP-seq
MIRT1234412	hsa-miR-4490	CLIP-seq
MIRT1234413	hsa-miR-4493	CLIP-seq
MIRT1234414	hsa-miR-4494	CLIP-seq
MIRT1234415	hsa-miR-4497	CLIP-seq
MIRT1234416	hsa-miR-4499	CLIP-seq
MIRT1234417	hsa-miR-4511	CLIP-seq
MIRT1234418	hsa-miR-4518	CLIP-seq
MIRT1234419	hsa-miR-4524	CLIP-seq
MIRT1234420	hsa-miR-4529-3p	CLIP-seq
MIRT1234421	hsa-miR-455-3p	CLIP-seq
MIRT1234422	hsa-miR-4639-5p	CLIP-seq
MIRT1234423	hsa-miR-4642	CLIP-seq
MIRT1234424	hsa-miR-4644	CLIP-seq
MIRT1234425	hsa-miR-4651	CLIP-seq
MIRT1234426	hsa-miR-4652-3p	CLIP-seq
MIRT1234427	hsa-miR-4659a-3p	CLIP-seq
MIRT1234428	hsa-miR-4659b-3p	CLIP-seq
MIRT1234429	hsa-miR-4660	CLIP-seq
MIRT1234430	hsa-miR-4664-5p	CLIP-seq
MIRT1234431	hsa-miR-4684-3p	CLIP-seq
MIRT1234432	hsa-miR-4695-3p	CLIP-seq
MIRT1234433	hsa-miR-4696	CLIP-seq
MIRT1234434	hsa-miR-4698	CLIP-seq
MIRT1234435	hsa-miR-4699-3p	CLIP-seq
MIRT1234436	hsa-miR-4703-5p	CLIP-seq
MIRT1234437	hsa-miR-4704-3p	CLIP-seq
MIRT1234438	hsa-miR-4711-3p	CLIP-seq
MIRT1234439	hsa-miR-4712-3p	CLIP-seq
MIRT1234440	hsa-miR-4713-5p	CLIP-seq
MIRT1234441	hsa-miR-4717-3p	CLIP-seq
MIRT1234442	hsa-miR-4720-5p	CLIP-seq
MIRT1234443	hsa-miR-4723-3p	CLIP-seq
MIRT1234444	hsa-miR-4724-5p	CLIP-seq
MIRT1234445	hsa-miR-4725-3p	CLIP-seq
MIRT1234446	hsa-miR-4727-5p	CLIP-seq
MIRT1234447	hsa-miR-4729	CLIP-seq
MIRT1234448	hsa-miR-4731-5p	CLIP-seq
MIRT1234449	hsa-miR-4745-5p	CLIP-seq
MIRT1234450	hsa-miR-4746-3p	CLIP-seq
MIRT1234451	hsa-miR-4757-5p	CLIP-seq
MIRT1234452	hsa-miR-4758-5p	CLIP-seq
MIRT1234453	hsa-miR-4766-5p	CLIP-seq
MIRT1234454	hsa-miR-4770	CLIP-seq
MIRT1234455	hsa-miR-4771	CLIP-seq
MIRT1234456	hsa-miR-4773	CLIP-seq
MIRT1234457	hsa-miR-4774-3p	CLIP-seq
MIRT1234458	hsa-miR-4778-5p	CLIP-seq
MIRT1234459	hsa-miR-4780	CLIP-seq
MIRT1234460	hsa-miR-4786-3p	CLIP-seq
MIRT1234461	hsa-miR-4792	CLIP-seq
MIRT1234462	hsa-miR-4799-3p	CLIP-seq
MIRT1234463	hsa-miR-4799-5p	CLIP-seq
MIRT1234464	hsa-miR-485-3p	CLIP-seq
MIRT1234465	hsa-miR-487a	CLIP-seq
MIRT1234466	hsa-miR-488	CLIP-seq
MIRT1234467	hsa-miR-489	CLIP-seq
MIRT1234468	hsa-miR-491-5p	CLIP-seq
MIRT1234469	hsa-miR-493	CLIP-seq
MIRT1234470	hsa-miR-496	CLIP-seq
MIRT1234471	hsa-miR-497	CLIP-seq
MIRT1234472	hsa-miR-498	CLIP-seq
MIRT1234473	hsa-miR-499a-5p	CLIP-seq
MIRT1234474	hsa-miR-503	CLIP-seq
MIRT1234475	hsa-miR-5047	CLIP-seq
MIRT1234476	hsa-miR-508-3p	CLIP-seq
MIRT1234477	hsa-miR-508-5p	CLIP-seq
MIRT1234478	hsa-miR-5096	CLIP-seq
MIRT1234479	hsa-miR-512-5p	CLIP-seq
MIRT1234480	hsa-miR-513a-5p	CLIP-seq
MIRT1234481	hsa-miR-514	CLIP-seq
MIRT1234482	hsa-miR-514b-3p	CLIP-seq
MIRT1234483	hsa-miR-518a-5p	CLIP-seq
MIRT1234484	hsa-miR-520a-5p	CLIP-seq
MIRT1234485	hsa-miR-520d-5p	CLIP-seq
MIRT1234486	hsa-miR-522	CLIP-seq
MIRT1234487	hsa-miR-524-5p	CLIP-seq
MIRT1234488	hsa-miR-525-5p	CLIP-seq
MIRT1234489	hsa-miR-527	CLIP-seq
MIRT1234490	hsa-miR-532-3p	CLIP-seq
MIRT1234491	hsa-miR-541	CLIP-seq
MIRT1234492	hsa-miR-544	CLIP-seq
MIRT1234493	hsa-miR-545	CLIP-seq
MIRT1234494	hsa-miR-548a-3p	CLIP-seq
MIRT1234495	hsa-miR-548a-5p	CLIP-seq
MIRT1234496	hsa-miR-548aa	CLIP-seq
MIRT1234497	hsa-miR-548ab	CLIP-seq
MIRT1234498	hsa-miR-548ac	CLIP-seq
MIRT1234499	hsa-miR-548ae	CLIP-seq
MIRT1234500	hsa-miR-548ah	CLIP-seq
MIRT1234501	hsa-miR-548aj	CLIP-seq
MIRT1234502	hsa-miR-548ak	CLIP-seq
MIRT1234503	hsa-miR-548am	CLIP-seq
MIRT1234504	hsa-miR-548an	CLIP-seq
MIRT1234505	hsa-miR-548b-3p	CLIP-seq
MIRT1234506	hsa-miR-548b-5p	CLIP-seq
MIRT1234507	hsa-miR-548c-5p	CLIP-seq
MIRT1234508	hsa-miR-548d-3p	CLIP-seq
MIRT1234509	hsa-miR-548d-5p	CLIP-seq
MIRT1234510	hsa-miR-548e	CLIP-seq
MIRT1234511	hsa-miR-548f	CLIP-seq
MIRT1234512	hsa-miR-548h	CLIP-seq
MIRT1234513	hsa-miR-548i	CLIP-seq
MIRT1234514	hsa-miR-548j	CLIP-seq
MIRT1234515	hsa-miR-548p	CLIP-seq
MIRT1234516	hsa-miR-548q	CLIP-seq
MIRT1234517	hsa-miR-548v	CLIP-seq
MIRT1234518	hsa-miR-548w	CLIP-seq
MIRT1234519	hsa-miR-548x	CLIP-seq
MIRT1234520	hsa-miR-548y	CLIP-seq
MIRT1234521	hsa-miR-548z	CLIP-seq
MIRT1234522	hsa-miR-555	CLIP-seq
MIRT1234523	hsa-miR-559	CLIP-seq
MIRT1234524	hsa-miR-572	CLIP-seq
MIRT1234525	hsa-miR-579	CLIP-seq
MIRT1234526	hsa-miR-584	CLIP-seq
MIRT1234527	hsa-miR-590-5p	CLIP-seq
MIRT1234528	hsa-miR-591	CLIP-seq
MIRT1234529	hsa-miR-607	CLIP-seq
MIRT1234530	hsa-miR-608	CLIP-seq
MIRT1234531	hsa-miR-616	CLIP-seq
MIRT1234532	hsa-miR-623	CLIP-seq
MIRT1234533	hsa-miR-629	CLIP-seq
MIRT1234534	hsa-miR-632	CLIP-seq
MIRT1234535	hsa-miR-641	CLIP-seq
MIRT1234536	hsa-miR-654-5p	CLIP-seq
MIRT1234537	hsa-miR-656	CLIP-seq
MIRT1234538	hsa-miR-659	CLIP-seq
MIRT1234539	hsa-miR-664	CLIP-seq
MIRT1234540	hsa-miR-766	CLIP-seq
MIRT1234541	hsa-miR-767-5p	CLIP-seq
MIRT1234542	hsa-miR-802	CLIP-seq
MIRT1234543	hsa-miR-875-3p	CLIP-seq
MIRT1234544	hsa-miR-892b	CLIP-seq
MIRT1234545	hsa-miR-936	CLIP-seq
MIRT1234284	hsa-miR-105	CLIP-seq
MIRT1234546	hsa-miR-106a	CLIP-seq
MIRT1234547	hsa-miR-106b	CLIP-seq
MIRT1234548	hsa-miR-1184	CLIP-seq
MIRT1234549	hsa-miR-1229	CLIP-seq
MIRT1234550	hsa-miR-124	CLIP-seq
MIRT1234288	hsa-miR-1243	CLIP-seq
MIRT1234551	hsa-miR-1244	CLIP-seq
MIRT1234552	hsa-miR-1257	CLIP-seq
MIRT1234553	hsa-miR-1258	CLIP-seq
MIRT1234554	hsa-miR-1265	CLIP-seq
MIRT1234292	hsa-miR-1266	CLIP-seq
MIRT1234555	hsa-miR-1271	CLIP-seq
MIRT1234556	hsa-miR-1273f	CLIP-seq
MIRT1234296	hsa-miR-127-5p	CLIP-seq
MIRT1234557	hsa-miR-1276	CLIP-seq
MIRT1234298	hsa-miR-1279	CLIP-seq
MIRT1234304	hsa-miR-1301	CLIP-seq
MIRT1234558	hsa-miR-1304	CLIP-seq
MIRT1234305	hsa-miR-1305	CLIP-seq
MIRT1234559	hsa-miR-1324	CLIP-seq
MIRT1234307	hsa-miR-136	CLIP-seq
MIRT1234309	hsa-miR-143	CLIP-seq
MIRT1234560	hsa-miR-149	CLIP-seq
MIRT1234561	hsa-miR-153	CLIP-seq
MIRT1234562	hsa-miR-17	CLIP-seq
MIRT1234314	hsa-miR-181a	CLIP-seq
MIRT1234315	hsa-miR-181b	CLIP-seq
MIRT1234316	hsa-miR-181c	CLIP-seq
MIRT1234317	hsa-miR-181d	CLIP-seq
MIRT1234319	hsa-miR-188-5p	CLIP-seq
MIRT1234320	hsa-miR-193a-3p	CLIP-seq
MIRT1234321	hsa-miR-193b	CLIP-seq
MIRT1234563	hsa-miR-1972	CLIP-seq
MIRT1234324	hsa-miR-199a-5p	CLIP-seq
MIRT1234325	hsa-miR-199b-3p	CLIP-seq
MIRT1234326	hsa-miR-199b-5p	CLIP-seq
MIRT1234328	hsa-miR-204	CLIP-seq
MIRT1234564	hsa-miR-2052	CLIP-seq
MIRT1234565	hsa-miR-20a	CLIP-seq
MIRT1234566	hsa-miR-20b	CLIP-seq
MIRT1234330	hsa-miR-21	CLIP-seq
MIRT1234331	hsa-miR-211	CLIP-seq
MIRT1234332	hsa-miR-2110	CLIP-seq
MIRT1234567	hsa-miR-219-2-3p	CLIP-seq
MIRT1234568	hsa-miR-2392	CLIP-seq
MIRT1234569	hsa-miR-28-3p	CLIP-seq
MIRT1234570	hsa-miR-2964a-3p	CLIP-seq
MIRT1234571	hsa-miR-3064-5p	CLIP-seq
MIRT1234346	hsa-miR-3065-5p	CLIP-seq
MIRT1234572	hsa-miR-3117-3p	CLIP-seq
MIRT1234573	hsa-miR-3119	CLIP-seq
MIRT1234574	hsa-miR-3120-5p	CLIP-seq
MIRT1234575	hsa-miR-3128	CLIP-seq
MIRT1234348	hsa-miR-3129-5p	CLIP-seq
MIRT1234350	hsa-miR-3152-5p	CLIP-seq
MIRT1234576	hsa-miR-3156-5p	CLIP-seq
MIRT1234577	hsa-miR-3157-5p	CLIP-seq
MIRT1234578	hsa-miR-3169	CLIP-seq
MIRT1234579	hsa-miR-3173-3p	CLIP-seq
MIRT1234353	hsa-miR-3182	CLIP-seq
MIRT1234580	hsa-miR-3200-3p	CLIP-seq
MIRT1234359	hsa-miR-323b-3p	CLIP-seq
MIRT1234360	hsa-miR-329	CLIP-seq
MIRT1234362	hsa-miR-338-5p	CLIP-seq
MIRT1234363	hsa-miR-339-3p	CLIP-seq
MIRT1234364	hsa-miR-342-5p	CLIP-seq
MIRT1234581	hsa-miR-3545-3p	CLIP-seq
MIRT1234582	hsa-miR-3607-3p	CLIP-seq
MIRT1234366	hsa-miR-3611	CLIP-seq
MIRT1234583	hsa-miR-3612	CLIP-seq
MIRT1234367	hsa-miR-3613-3p	CLIP-seq
MIRT1234584	hsa-miR-3614-3p	CLIP-seq
MIRT1234585	hsa-miR-3616-3p	CLIP-seq
MIRT1234586	hsa-miR-3653	CLIP-seq
MIRT1234373	hsa-miR-3654	CLIP-seq
MIRT1234587	hsa-miR-3664-3p	CLIP-seq
MIRT1234376	hsa-miR-3679-3p	CLIP-seq
MIRT1234588	hsa-miR-3686	CLIP-seq
MIRT1234589	hsa-miR-3692	CLIP-seq
MIRT1234590	hsa-miR-369-3p	CLIP-seq
MIRT1234591	hsa-miR-3714	CLIP-seq
MIRT1234592	hsa-miR-374c	CLIP-seq
MIRT1234382	hsa-miR-3910	CLIP-seq
MIRT1234383	hsa-miR-3913-3p	CLIP-seq
MIRT1234593	hsa-miR-410	CLIP-seq
MIRT1234594	hsa-miR-425	CLIP-seq
MIRT1234390	hsa-miR-4255	CLIP-seq
MIRT1234391	hsa-miR-4261	CLIP-seq
MIRT1234392	hsa-miR-4262	CLIP-seq
MIRT1234394	hsa-miR-4271	CLIP-seq
MIRT1234595	hsa-miR-4291	CLIP-seq
MIRT1234596	hsa-miR-4307	CLIP-seq
MIRT1234597	hsa-miR-4311	CLIP-seq
MIRT1234400	hsa-miR-4312	CLIP-seq
MIRT1234598	hsa-miR-4418	CLIP-seq
MIRT1234403	hsa-miR-4422	CLIP-seq
MIRT1234404	hsa-miR-4423-5p	CLIP-seq
MIRT1234599	hsa-miR-4469	CLIP-seq
MIRT1234413	hsa-miR-4493	CLIP-seq
MIRT1234600	hsa-miR-4495	CLIP-seq
MIRT1234601	hsa-miR-4502	CLIP-seq
MIRT1234602	hsa-miR-4517	CLIP-seq
MIRT1234418	hsa-miR-4518	CLIP-seq
MIRT1234421	hsa-miR-455-3p	CLIP-seq
MIRT1234423	hsa-miR-4642	CLIP-seq
MIRT1234603	hsa-miR-4650-5p	CLIP-seq
MIRT1234425	hsa-miR-4651	CLIP-seq
MIRT1234427	hsa-miR-4659a-3p	CLIP-seq
MIRT1234428	hsa-miR-4659b-3p	CLIP-seq
MIRT1234429	hsa-miR-4660	CLIP-seq
MIRT1234430	hsa-miR-4664-5p	CLIP-seq
MIRT1234604	hsa-miR-4666-3p	CLIP-seq
MIRT1234605	hsa-miR-4680-5p	CLIP-seq
MIRT1234606	hsa-miR-4695-5p	CLIP-seq
MIRT1234435	hsa-miR-4699-3p	CLIP-seq
MIRT1234607	hsa-miR-4699-5p	CLIP-seq
MIRT1234608	hsa-miR-4705	CLIP-seq
MIRT1234609	hsa-miR-4708-5p	CLIP-seq
MIRT1234610	hsa-miR-4709-3p	CLIP-seq
MIRT1234611	hsa-miR-4720-3p	CLIP-seq
MIRT1234442	hsa-miR-4720-5p	CLIP-seq
MIRT1234612	hsa-miR-4721	CLIP-seq
MIRT1234444	hsa-miR-4724-5p	CLIP-seq
MIRT1234445	hsa-miR-4725-3p	CLIP-seq
MIRT1234613	hsa-miR-4759	CLIP-seq
MIRT1234453	hsa-miR-4766-5p	CLIP-seq
MIRT1234454	hsa-miR-4770	CLIP-seq
MIRT1234458	hsa-miR-4778-5p	CLIP-seq
MIRT1234460	hsa-miR-4786-3p	CLIP-seq
MIRT1234614	hsa-miR-4790-5p	CLIP-seq
MIRT1234461	hsa-miR-4792	CLIP-seq
MIRT1234615	hsa-miR-4794	CLIP-seq
MIRT1234462	hsa-miR-4799-3p	CLIP-seq
MIRT1234463	hsa-miR-4799-5p	CLIP-seq
MIRT1234616	hsa-miR-4804-3p	CLIP-seq
MIRT1234466	hsa-miR-488	CLIP-seq
MIRT1234467	hsa-miR-489	CLIP-seq
MIRT1234468	hsa-miR-491-5p	CLIP-seq
MIRT1234469	hsa-miR-493	CLIP-seq
MIRT1234617	hsa-miR-495	CLIP-seq
MIRT1234472	hsa-miR-498	CLIP-seq
MIRT1234475	hsa-miR-5047	CLIP-seq
MIRT1234618	hsa-miR-506	CLIP-seq
MIRT1234619	hsa-miR-509-3-5p	CLIP-seq
MIRT1234620	hsa-miR-509-5p	CLIP-seq
MIRT1234621	hsa-miR-513b	CLIP-seq
MIRT1234481	hsa-miR-514	CLIP-seq
MIRT1234482	hsa-miR-514b-3p	CLIP-seq
MIRT1234483	hsa-miR-518a-5p	CLIP-seq
MIRT1234622	hsa-miR-519a	CLIP-seq
MIRT1234623	hsa-miR-519b-3p	CLIP-seq
MIRT1234624	hsa-miR-519c-3p	CLIP-seq
MIRT1234625	hsa-miR-519d	CLIP-seq
MIRT1234485	hsa-miR-520d-5p	CLIP-seq
MIRT1234487	hsa-miR-524-5p	CLIP-seq
MIRT1234489	hsa-miR-527	CLIP-seq
MIRT1234626	hsa-miR-539	CLIP-seq
MIRT1234493	hsa-miR-545	CLIP-seq
MIRT1234494	hsa-miR-548a-3p	CLIP-seq
MIRT1234499	hsa-miR-548ae	CLIP-seq
MIRT1234501	hsa-miR-548aj	CLIP-seq
MIRT1234503	hsa-miR-548am	CLIP-seq
MIRT1234510	hsa-miR-548e	CLIP-seq
MIRT1234511	hsa-miR-548f	CLIP-seq
MIRT1234515	hsa-miR-548p	CLIP-seq
MIRT1234519	hsa-miR-548x	CLIP-seq
MIRT1234627	hsa-miR-583	CLIP-seq
MIRT1234628	hsa-miR-586	CLIP-seq
MIRT1234527	hsa-miR-590-5p	CLIP-seq
MIRT1234530	hsa-miR-608	CLIP-seq
MIRT1234531	hsa-miR-616	CLIP-seq
MIRT1234629	hsa-miR-647	CLIP-seq
MIRT1234630	hsa-miR-650	CLIP-seq
MIRT1234631	hsa-miR-651	CLIP-seq
MIRT1234632	hsa-miR-655	CLIP-seq
MIRT1234537	hsa-miR-656	CLIP-seq
MIRT1234539	hsa-miR-664	CLIP-seq
MIRT1234633	hsa-miR-758	CLIP-seq
MIRT1234543	hsa-miR-875-3p	CLIP-seq
MIRT1234634	hsa-miR-887	CLIP-seq
MIRT1234635	hsa-miR-891b	CLIP-seq
MIRT1234544	hsa-miR-892b	CLIP-seq
MIRT1234636	hsa-miR-93	CLIP-seq
MIRT1234545	hsa-miR-936	CLIP-seq
MIRT1234637	hsa-miR-942	CLIP-seq
MIRT1234638	hsa-miR-96	CLIP-seq
MIRT1234353	hsa-miR-3182	CLIP-seq
MIRT1234354	hsa-miR-3183	CLIP-seq
MIRT1234395	hsa-miR-4279	CLIP-seq
MIRT1234602	hsa-miR-4517	CLIP-seq
MIRT1234427	hsa-miR-4659a-3p	CLIP-seq
MIRT1234428	hsa-miR-4659b-3p	CLIP-seq
MIRT1234443	hsa-miR-4723-3p	CLIP-seq
MIRT1234446	hsa-miR-4727-5p	CLIP-seq
MIRT1234285	hsa-miR-1207-3p	CLIP-seq
MIRT1234286	hsa-miR-1231	CLIP-seq
MIRT1234287	hsa-miR-1233	CLIP-seq
MIRT2069011	hsa-miR-1237	CLIP-seq
MIRT2069012	hsa-miR-1238	CLIP-seq
MIRT1234288	hsa-miR-1243	CLIP-seq
MIRT2069013	hsa-miR-1248	CLIP-seq
MIRT1234290	hsa-miR-1253	CLIP-seq
MIRT1234291	hsa-miR-1256	CLIP-seq
MIRT2069014	hsa-miR-1261	CLIP-seq
MIRT1234554	hsa-miR-1265	CLIP-seq
MIRT1234292	hsa-miR-1266	CLIP-seq
MIRT1234293	hsa-miR-1267	CLIP-seq
MIRT1234557	hsa-miR-1276	CLIP-seq
MIRT1234298	hsa-miR-1279	CLIP-seq
MIRT1234299	hsa-miR-128	CLIP-seq
MIRT2069015	hsa-miR-1288	CLIP-seq
MIRT1234301	hsa-miR-129-3p	CLIP-seq
MIRT1234303	hsa-miR-129-5p	CLIP-seq
MIRT1234304	hsa-miR-1301	CLIP-seq
MIRT2069016	hsa-miR-1322	CLIP-seq
MIRT1234559	hsa-miR-1324	CLIP-seq
MIRT1234307	hsa-miR-136	CLIP-seq
MIRT2069017	hsa-miR-144	CLIP-seq
MIRT1234560	hsa-miR-149	CLIP-seq
MIRT1234310	hsa-miR-150	CLIP-seq
MIRT1234314	hsa-miR-181a	CLIP-seq
MIRT1234315	hsa-miR-181b	CLIP-seq
MIRT1234316	hsa-miR-181c	CLIP-seq
MIRT1234317	hsa-miR-181d	CLIP-seq
MIRT1234318	hsa-miR-185	CLIP-seq
MIRT1234319	hsa-miR-188-5p	CLIP-seq
MIRT2069018	hsa-miR-1976	CLIP-seq
MIRT2069019	hsa-miR-198	CLIP-seq
MIRT1234325	hsa-miR-199b-3p	CLIP-seq
MIRT1234333	hsa-miR-221	CLIP-seq
MIRT1234334	hsa-miR-222	CLIP-seq
MIRT1234335	hsa-miR-223	CLIP-seq
MIRT1234336	hsa-miR-2276	CLIP-seq
MIRT2069020	hsa-miR-2278	CLIP-seq
MIRT2069021	hsa-miR-2355-3p	CLIP-seq
MIRT1234568	hsa-miR-2392	CLIP-seq
MIRT1234341	hsa-miR-27a	CLIP-seq
MIRT1234342	hsa-miR-27b	CLIP-seq
MIRT1234343	hsa-miR-29a	CLIP-seq
MIRT1234344	hsa-miR-29b	CLIP-seq
MIRT1234345	hsa-miR-29c	CLIP-seq
MIRT1234571	hsa-miR-3064-5p	CLIP-seq
MIRT1234346	hsa-miR-3065-5p	CLIP-seq
MIRT2069022	hsa-miR-3074-5p	CLIP-seq
MIRT1234572	hsa-miR-3117-3p	CLIP-seq
MIRT1234573	hsa-miR-3119	CLIP-seq
MIRT1234347	hsa-miR-3121-5p	CLIP-seq
MIRT2069023	hsa-miR-3124-3p	CLIP-seq
MIRT1234575	hsa-miR-3128	CLIP-seq
MIRT1234348	hsa-miR-3129-5p	CLIP-seq
MIRT2069024	hsa-miR-3153	CLIP-seq
MIRT2069025	hsa-miR-3157-3p	CLIP-seq
MIRT1234577	hsa-miR-3157-5p	CLIP-seq
MIRT1234351	hsa-miR-3160-5p	CLIP-seq
MIRT2069026	hsa-miR-3167	CLIP-seq
MIRT1234578	hsa-miR-3169	CLIP-seq
MIRT1234352	hsa-miR-3180-5p	CLIP-seq
MIRT1234353	hsa-miR-3182	CLIP-seq
MIRT1234354	hsa-miR-3183	CLIP-seq
MIRT1234355	hsa-miR-320a	CLIP-seq
MIRT1234356	hsa-miR-320b	CLIP-seq
MIRT1234357	hsa-miR-320c	CLIP-seq
MIRT1234358	hsa-miR-320d	CLIP-seq
MIRT1234359	hsa-miR-323b-3p	CLIP-seq
MIRT1234360	hsa-miR-329	CLIP-seq
MIRT1234361	hsa-miR-330-3p	CLIP-seq
MIRT1234362	hsa-miR-338-5p	CLIP-seq
MIRT1234581	hsa-miR-3545-3p	CLIP-seq
MIRT2069027	hsa-miR-3606	CLIP-seq
MIRT1234365	hsa-miR-3609	CLIP-seq
MIRT2069028	hsa-miR-3614-5p	CLIP-seq
MIRT1234369	hsa-miR-361-5p	CLIP-seq
MIRT1234370	hsa-miR-3617	CLIP-seq
MIRT1234372	hsa-miR-3646	CLIP-seq
MIRT1234373	hsa-miR-3654	CLIP-seq
MIRT1234589	hsa-miR-3692	CLIP-seq
MIRT1234590	hsa-miR-369-3p	CLIP-seq
MIRT1234592	hsa-miR-374c	CLIP-seq
MIRT2069029	hsa-miR-382	CLIP-seq
MIRT1234380	hsa-miR-383	CLIP-seq
MIRT1234385	hsa-miR-3925-3p	CLIP-seq
MIRT1234594	hsa-miR-425	CLIP-seq
MIRT2069030	hsa-miR-4252	CLIP-seq
MIRT1234391	hsa-miR-4261	CLIP-seq
MIRT1234392	hsa-miR-4262	CLIP-seq
MIRT1234393	hsa-miR-4267	CLIP-seq
MIRT1234395	hsa-miR-4279	CLIP-seq
MIRT1234396	hsa-miR-4286	CLIP-seq
MIRT1234397	hsa-miR-4288	CLIP-seq
MIRT1234399	hsa-miR-4306	CLIP-seq
MIRT1234597	hsa-miR-4311	CLIP-seq
MIRT2069031	hsa-miR-4320	CLIP-seq
MIRT1234403	hsa-miR-4422	CLIP-seq
MIRT1234405	hsa-miR-4429	CLIP-seq
MIRT2069032	hsa-miR-4433	CLIP-seq
MIRT2069033	hsa-miR-4434	CLIP-seq
MIRT2069034	hsa-miR-4459	CLIP-seq
MIRT1234407	hsa-miR-4463	CLIP-seq
MIRT1234410	hsa-miR-4481	CLIP-seq
MIRT1234411	hsa-miR-4484	CLIP-seq
MIRT1234412	hsa-miR-4490	CLIP-seq
MIRT1234414	hsa-miR-4494	CLIP-seq
MIRT1234600	hsa-miR-4495	CLIP-seq
MIRT1234416	hsa-miR-4499	CLIP-seq
MIRT2069035	hsa-miR-4516	CLIP-seq
MIRT1234418	hsa-miR-4518	CLIP-seq
MIRT2069036	hsa-miR-4519	CLIP-seq
MIRT2069037	hsa-miR-4539	CLIP-seq
MIRT1234421	hsa-miR-455-3p	CLIP-seq
MIRT1234424	hsa-miR-4644	CLIP-seq
MIRT2069038	hsa-miR-4645-3p	CLIP-seq
MIRT2069039	hsa-miR-4646-3p	CLIP-seq
MIRT1234426	hsa-miR-4652-3p	CLIP-seq
MIRT1234427	hsa-miR-4659a-3p	CLIP-seq
MIRT1234428	hsa-miR-4659b-3p	CLIP-seq
MIRT1234429	hsa-miR-4660	CLIP-seq
MIRT1234604	hsa-miR-4666-3p	CLIP-seq
MIRT2069040	hsa-miR-4668-5p	CLIP-seq
MIRT2069041	hsa-miR-4691-5p	CLIP-seq
MIRT2069042	hsa-miR-4694-3p	CLIP-seq
MIRT1234606	hsa-miR-4695-5p	CLIP-seq
MIRT1234433	hsa-miR-4696	CLIP-seq
MIRT1234438	hsa-miR-4711-3p	CLIP-seq
MIRT1234439	hsa-miR-4712-3p	CLIP-seq
MIRT1234440	hsa-miR-4713-5p	CLIP-seq
MIRT1234442	hsa-miR-4720-5p	CLIP-seq
MIRT2069043	hsa-miR-4722-3p	CLIP-seq
MIRT1234443	hsa-miR-4723-3p	CLIP-seq
MIRT1234444	hsa-miR-4724-5p	CLIP-seq
MIRT1234446	hsa-miR-4727-5p	CLIP-seq
MIRT1234447	hsa-miR-4729	CLIP-seq
MIRT1234448	hsa-miR-4731-5p	CLIP-seq
MIRT1234449	hsa-miR-4745-5p	CLIP-seq
MIRT1234451	hsa-miR-4757-5p	CLIP-seq
MIRT1234452	hsa-miR-4758-5p	CLIP-seq
MIRT1234453	hsa-miR-4766-5p	CLIP-seq
MIRT2069044	hsa-miR-4768-3p	CLIP-seq
MIRT1234459	hsa-miR-4780	CLIP-seq
MIRT1234615	hsa-miR-4794	CLIP-seq
MIRT2069045	hsa-miR-4796-5p	CLIP-seq
MIRT1234462	hsa-miR-4799-3p	CLIP-seq
MIRT1234463	hsa-miR-4799-5p	CLIP-seq
MIRT2069046	hsa-miR-483-3p	CLIP-seq
MIRT1234466	hsa-miR-488	CLIP-seq
MIRT2069047	hsa-miR-494	CLIP-seq
MIRT1234473	hsa-miR-499a-5p	CLIP-seq
MIRT1234475	hsa-miR-5047	CLIP-seq
MIRT1234478	hsa-miR-5096	CLIP-seq
MIRT1234479	hsa-miR-512-5p	CLIP-seq
MIRT1234480	hsa-miR-513a-5p	CLIP-seq
MIRT1234481	hsa-miR-514	CLIP-seq
MIRT1234482	hsa-miR-514b-3p	CLIP-seq
MIRT1234484	hsa-miR-520a-5p	CLIP-seq
MIRT2069048	hsa-miR-520g	CLIP-seq
MIRT2069049	hsa-miR-520h	CLIP-seq
MIRT1234486	hsa-miR-522	CLIP-seq
MIRT1234488	hsa-miR-525-5p	CLIP-seq
MIRT1234490	hsa-miR-532-3p	CLIP-seq
MIRT1234492	hsa-miR-544	CLIP-seq
MIRT1234493	hsa-miR-545	CLIP-seq
MIRT1234494	hsa-miR-548a-3p	CLIP-seq
MIRT1234496	hsa-miR-548aa	CLIP-seq
MIRT1234498	hsa-miR-548ac	CLIP-seq
MIRT1234499	hsa-miR-548ae	CLIP-seq
MIRT1234500	hsa-miR-548ah	CLIP-seq
MIRT1234501	hsa-miR-548aj	CLIP-seq
MIRT1234503	hsa-miR-548am	CLIP-seq
MIRT1234504	hsa-miR-548an	CLIP-seq
MIRT2069050	hsa-miR-548c-3p	CLIP-seq
MIRT1234508	hsa-miR-548d-3p	CLIP-seq
MIRT1234510	hsa-miR-548e	CLIP-seq
MIRT1234511	hsa-miR-548f	CLIP-seq
MIRT2069051	hsa-miR-548g	CLIP-seq
MIRT1234515	hsa-miR-548p	CLIP-seq
MIRT1234517	hsa-miR-548v	CLIP-seq
MIRT1234519	hsa-miR-548x	CLIP-seq
MIRT1234521	hsa-miR-548z	CLIP-seq
MIRT2069052	hsa-miR-570	CLIP-seq
MIRT1234524	hsa-miR-572	CLIP-seq
MIRT1234525	hsa-miR-579	CLIP-seq
MIRT1234627	hsa-miR-583	CLIP-seq
MIRT1234528	hsa-miR-591	CLIP-seq
MIRT1234531	hsa-miR-616	CLIP-seq
MIRT1234532	hsa-miR-623	CLIP-seq
MIRT1234533	hsa-miR-629	CLIP-seq
MIRT1234534	hsa-miR-632	CLIP-seq
MIRT2069053	hsa-miR-634	CLIP-seq
MIRT1234535	hsa-miR-641	CLIP-seq
MIRT1234631	hsa-miR-651	CLIP-seq
MIRT1234632	hsa-miR-655	CLIP-seq
MIRT1234537	hsa-miR-656	CLIP-seq
MIRT1234539	hsa-miR-664	CLIP-seq
MIRT1234540	hsa-miR-766	CLIP-seq
MIRT1234541	hsa-miR-767-5p	CLIP-seq
MIRT2069054	hsa-miR-769-5p	CLIP-seq
MIRT2069055	hsa-miR-873	CLIP-seq
MIRT1234543	hsa-miR-875-3p	CLIP-seq
MIRT2069056	hsa-miR-876-5p	CLIP-seq
MIRT2069057	hsa-miR-890	CLIP-seq
MIRT1234635	hsa-miR-891b	CLIP-seq
MIRT2069058	hsa-miR-892a	CLIP-seq
MIRT1234545	hsa-miR-936	CLIP-seq
MIRT2069059	hsa-miR-943	CLIP-seq
MIRT1234286	hsa-miR-1231	CLIP-seq
MIRT1234299	hsa-miR-128	CLIP-seq
MIRT1234305	hsa-miR-1305	CLIP-seq
MIRT1234332	hsa-miR-2110	CLIP-seq
MIRT1234333	hsa-miR-221	CLIP-seq
MIRT1234334	hsa-miR-222	CLIP-seq
MIRT2296083	hsa-miR-2277-3p	CLIP-seq
MIRT1234346	hsa-miR-3065-5p	CLIP-seq
MIRT2069022	hsa-miR-3074-5p	CLIP-seq
MIRT1234575	hsa-miR-3128	CLIP-seq
MIRT1234359	hsa-miR-323b-3p	CLIP-seq
MIRT1234364	hsa-miR-342-5p	CLIP-seq
MIRT2069028	hsa-miR-3614-5p	CLIP-seq
MIRT1234594	hsa-miR-425	CLIP-seq
MIRT2069030	hsa-miR-4252	CLIP-seq
MIRT1234394	hsa-miR-4271	CLIP-seq
MIRT2069031	hsa-miR-4320	CLIP-seq
MIRT1234421	hsa-miR-455-3p	CLIP-seq
MIRT1234425	hsa-miR-4651	CLIP-seq
MIRT1234430	hsa-miR-4664-5p	CLIP-seq
MIRT1234442	hsa-miR-4720-5p	CLIP-seq
MIRT1234445	hsa-miR-4725-3p	CLIP-seq
MIRT1234462	hsa-miR-4799-3p	CLIP-seq
MIRT1234468	hsa-miR-491-5p	CLIP-seq
MIRT1234472	hsa-miR-498	CLIP-seq
MIRT1234484	hsa-miR-520a-5p	CLIP-seq
MIRT1234486	hsa-miR-522	CLIP-seq
MIRT1234488	hsa-miR-525-5p	CLIP-seq
MIRT1234494	hsa-miR-548a-3p	CLIP-seq
MIRT1234499	hsa-miR-548ae	CLIP-seq
MIRT1234501	hsa-miR-548aj	CLIP-seq
MIRT1234503	hsa-miR-548am	CLIP-seq
MIRT2069050	hsa-miR-548c-3p	CLIP-seq
MIRT1234510	hsa-miR-548e	CLIP-seq
MIRT1234511	hsa-miR-548f	CLIP-seq
MIRT1234517	hsa-miR-548v	CLIP-seq
MIRT1234519	hsa-miR-548x	CLIP-seq
MIRT1234528	hsa-miR-591	CLIP-seq
MIRT1234530	hsa-miR-608	CLIP-seq
MIRT1234537	hsa-miR-656	CLIP-seq
MIRT2069057	hsa-miR-890	CLIP-seq
MIRT1234325	hsa-miR-199b-3p	CLIP-seq
MIRT1234348	hsa-miR-3129-5p	CLIP-seq
MIRT1234374	hsa-miR-3662	CLIP-seq
MIRT1234421	hsa-miR-455-3p	CLIP-seq
MIRT1234545	hsa-miR-936	CLIP-seq
MIRT1234359	hsa-miR-323b-3p	CLIP-seq
MIRT1234383	hsa-miR-3913-3p	CLIP-seq
MIRT1234599	hsa-miR-4469	CLIP-seq
MIRT1234467	hsa-miR-489	CLIP-seq
MIRT1234617	hsa-miR-495	CLIP-seq
MIRT1234499	hsa-miR-548ae	CLIP-seq
MIRT1234501	hsa-miR-548aj	CLIP-seq
MIRT1234503	hsa-miR-548am	CLIP-seq
MIRT1234519	hsa-miR-548x	CLIP-seq
MIRT2432131	hsa-miR-642a	CLIP-seq
MIRT1234537	hsa-miR-656	CLIP-seq
MIRT1234310	hsa-miR-150	CLIP-seq
MIRT2069022	hsa-miR-3074-5p	CLIP-seq
MIRT2069028	hsa-miR-3614-5p	CLIP-seq
MIRT2069030	hsa-miR-4252	CLIP-seq
MIRT2069031	hsa-miR-4320	CLIP-seq
MIRT1234410	hsa-miR-4481	CLIP-seq
MIRT1234440	hsa-miR-4713-5p	CLIP-seq
MIRT1234449	hsa-miR-4745-5p	CLIP-seq
MIRT1234452	hsa-miR-4758-5p	CLIP-seq
MIRT1234459	hsa-miR-4780	CLIP-seq
MIRT1234484	hsa-miR-520a-5p	CLIP-seq
MIRT1234488	hsa-miR-525-5p	CLIP-seq
MIRT1234490	hsa-miR-532-3p	CLIP-seq
MIRT1234528	hsa-miR-591	CLIP-seq
MIRT1234532	hsa-miR-623	CLIP-seq
MIRT2069057	hsa-miR-890	CLIP-seq
MIRT2465841	hsa-miR-3688-3p	CLIP-seq
MIRT2465842	hsa-miR-3978	CLIP-seq
MIRT2465843	hsa-miR-4266	CLIP-seq
MIRT2069042	hsa-miR-4694-3p	CLIP-seq
MIRT1234606	hsa-miR-4695-5p	CLIP-seq
MIRT2465844	hsa-miR-4779	CLIP-seq
MIRT1234286	hsa-miR-1231	CLIP-seq
MIRT1234552	hsa-miR-1257	CLIP-seq
MIRT1234294	hsa-miR-1269	CLIP-seq
MIRT1234295	hsa-miR-1269b	CLIP-seq
MIRT1234299	hsa-miR-128	CLIP-seq
MIRT1234305	hsa-miR-1305	CLIP-seq
MIRT1234310	hsa-miR-150	CLIP-seq
MIRT1234561	hsa-miR-153	CLIP-seq
MIRT1234314	hsa-miR-181a	CLIP-seq
MIRT1234315	hsa-miR-181b	CLIP-seq
MIRT1234316	hsa-miR-181c	CLIP-seq
MIRT1234317	hsa-miR-181d	CLIP-seq
MIRT1234319	hsa-miR-188-5p	CLIP-seq
MIRT2593974	hsa-miR-1973	CLIP-seq
MIRT1234333	hsa-miR-221	CLIP-seq
MIRT1234334	hsa-miR-222	CLIP-seq
MIRT1234570	hsa-miR-2964a-3p	CLIP-seq
MIRT1234346	hsa-miR-3065-5p	CLIP-seq
MIRT2593975	hsa-miR-3120-3p	CLIP-seq
MIRT1234353	hsa-miR-3182	CLIP-seq
MIRT1234359	hsa-miR-323b-3p	CLIP-seq
MIRT1234362	hsa-miR-338-5p	CLIP-seq
MIRT1234364	hsa-miR-342-5p	CLIP-seq
MIRT1234584	hsa-miR-3614-3p	CLIP-seq
MIRT1234372	hsa-miR-3646	CLIP-seq
MIRT2593976	hsa-miR-3647-3p	CLIP-seq
MIRT1234586	hsa-miR-3653	CLIP-seq
MIRT1234374	hsa-miR-3662	CLIP-seq
MIRT1234376	hsa-miR-3679-3p	CLIP-seq
MIRT1234387	hsa-miR-3942-5p	CLIP-seq
MIRT1234594	hsa-miR-425	CLIP-seq
MIRT1234392	hsa-miR-4262	CLIP-seq
MIRT1234595	hsa-miR-4291	CLIP-seq
MIRT1234410	hsa-miR-4481	CLIP-seq
MIRT1234415	hsa-miR-4497	CLIP-seq
MIRT1234420	hsa-miR-4529-3p	CLIP-seq
MIRT2069037	hsa-miR-4539	CLIP-seq
MIRT1234423	hsa-miR-4642	CLIP-seq
MIRT2593977	hsa-miR-4645-5p	CLIP-seq
MIRT1234425	hsa-miR-4651	CLIP-seq
MIRT1234427	hsa-miR-4659a-3p	CLIP-seq
MIRT1234428	hsa-miR-4659b-3p	CLIP-seq
MIRT1234430	hsa-miR-4664-5p	CLIP-seq
MIRT2593978	hsa-miR-4668-3p	CLIP-seq
MIRT2593979	hsa-miR-4673	CLIP-seq
MIRT1234434	hsa-miR-4698	CLIP-seq
MIRT1234435	hsa-miR-4699-3p	CLIP-seq
MIRT1234436	hsa-miR-4703-5p	CLIP-seq
MIRT1234438	hsa-miR-4711-3p	CLIP-seq
MIRT1234440	hsa-miR-4713-5p	CLIP-seq
MIRT1234449	hsa-miR-4745-5p	CLIP-seq
MIRT1234452	hsa-miR-4758-5p	CLIP-seq
MIRT1234459	hsa-miR-4780	CLIP-seq
MIRT1234468	hsa-miR-491-5p	CLIP-seq
MIRT1234617	hsa-miR-495	CLIP-seq
MIRT1234472	hsa-miR-498	CLIP-seq
MIRT1234479	hsa-miR-512-5p	CLIP-seq
MIRT1234621	hsa-miR-513b	CLIP-seq
MIRT1234485	hsa-miR-520d-5p	CLIP-seq
MIRT1234487	hsa-miR-524-5p	CLIP-seq
MIRT1234490	hsa-miR-532-3p	CLIP-seq
MIRT1234492	hsa-miR-544	CLIP-seq
MIRT1234493	hsa-miR-545	CLIP-seq
MIRT1234494	hsa-miR-548a-3p	CLIP-seq
MIRT1234499	hsa-miR-548ae	CLIP-seq
MIRT1234501	hsa-miR-548aj	CLIP-seq
MIRT1234503	hsa-miR-548am	CLIP-seq
MIRT2069050	hsa-miR-548c-3p	CLIP-seq
MIRT1234510	hsa-miR-548e	CLIP-seq
MIRT1234511	hsa-miR-548f	CLIP-seq
MIRT1234515	hsa-miR-548p	CLIP-seq
MIRT1234517	hsa-miR-548v	CLIP-seq
MIRT1234519	hsa-miR-548x	CLIP-seq
MIRT1234525	hsa-miR-579	CLIP-seq
MIRT1234530	hsa-miR-608	CLIP-seq
MIRT1234532	hsa-miR-623	CLIP-seq
MIRT1234537	hsa-miR-656	CLIP-seq
MIRT1234286	hsa-miR-1231	CLIP-seq
MIRT1234552	hsa-miR-1257	CLIP-seq
MIRT1234299	hsa-miR-128	CLIP-seq
MIRT1234305	hsa-miR-1305	CLIP-seq
MIRT1234310	hsa-miR-150	CLIP-seq
MIRT1234561	hsa-miR-153	CLIP-seq
MIRT2593974	hsa-miR-1973	CLIP-seq
MIRT1234332	hsa-miR-2110	CLIP-seq
MIRT1234333	hsa-miR-221	CLIP-seq
MIRT1234334	hsa-miR-222	CLIP-seq
MIRT1234570	hsa-miR-2964a-3p	CLIP-seq
MIRT1234346	hsa-miR-3065-5p	CLIP-seq
MIRT2593975	hsa-miR-3120-3p	CLIP-seq
MIRT1234359	hsa-miR-323b-3p	CLIP-seq
MIRT1234362	hsa-miR-338-5p	CLIP-seq
MIRT1234364	hsa-miR-342-5p	CLIP-seq
MIRT1234584	hsa-miR-3614-3p	CLIP-seq
MIRT1234372	hsa-miR-3646	CLIP-seq
MIRT2593976	hsa-miR-3647-3p	CLIP-seq
MIRT1234586	hsa-miR-3653	CLIP-seq
MIRT1234374	hsa-miR-3662	CLIP-seq
MIRT1234394	hsa-miR-4271	CLIP-seq
MIRT1234595	hsa-miR-4291	CLIP-seq
MIRT1234410	hsa-miR-4481	CLIP-seq
MIRT1234415	hsa-miR-4497	CLIP-seq
MIRT1234423	hsa-miR-4642	CLIP-seq
MIRT2593977	hsa-miR-4645-5p	CLIP-seq
MIRT1234425	hsa-miR-4651	CLIP-seq
MIRT1234430	hsa-miR-4664-5p	CLIP-seq
MIRT2593978	hsa-miR-4668-3p	CLIP-seq
MIRT2593979	hsa-miR-4673	CLIP-seq
MIRT1234434	hsa-miR-4698	CLIP-seq
MIRT1234435	hsa-miR-4699-3p	CLIP-seq
MIRT1234438	hsa-miR-4711-3p	CLIP-seq
MIRT1234440	hsa-miR-4713-5p	CLIP-seq
MIRT1234445	hsa-miR-4725-3p	CLIP-seq
MIRT1234449	hsa-miR-4745-5p	CLIP-seq
MIRT1234452	hsa-miR-4758-5p	CLIP-seq
MIRT1234459	hsa-miR-4780	CLIP-seq
MIRT1234468	hsa-miR-491-5p	CLIP-seq
MIRT1234617	hsa-miR-495	CLIP-seq
MIRT1234472	hsa-miR-498	CLIP-seq
MIRT1234485	hsa-miR-520d-5p	CLIP-seq
MIRT1234487	hsa-miR-524-5p	CLIP-seq
MIRT1234490	hsa-miR-532-3p	CLIP-seq
MIRT1234492	hsa-miR-544	CLIP-seq
MIRT1234493	hsa-miR-545	CLIP-seq
MIRT1234494	hsa-miR-548a-3p	CLIP-seq
MIRT1234499	hsa-miR-548ae	CLIP-seq
MIRT1234501	hsa-miR-548aj	CLIP-seq
MIRT1234503	hsa-miR-548am	CLIP-seq
MIRT2069050	hsa-miR-548c-3p	CLIP-seq
MIRT1234510	hsa-miR-548e	CLIP-seq
MIRT1234511	hsa-miR-548f	CLIP-seq
MIRT1234515	hsa-miR-548p	CLIP-seq
MIRT1234517	hsa-miR-548v	CLIP-seq
MIRT1234519	hsa-miR-548x	CLIP-seq
MIRT1234525	hsa-miR-579	CLIP-seq
MIRT1234530	hsa-miR-608	CLIP-seq
MIRT1234532	hsa-miR-623	CLIP-seq
MIRT1234537	hsa-miR-656	CLIP-seq

112

Show/Hide all (112)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001678	Process	Intracellular glucose homeostasis	IEA
GO:0001678	Process	Intracellular glucose homeostasis	ISS
GO:0001784	Function	Phosphotyrosine residue binding	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0001953	Process	Negative regulation of cell-matrix adhesion	IEA
GO:0002687	Process	Positive regulation of leukocyte migration	IEA
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	ISS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005158	Function	Insulin receptor binding	IPI	7537849
GO:0005159	Function	Insulin-like growth factor receptor binding	IPI	7541045
GO:0005168	Function	Neurotrophin TRKA receptor binding	IPI	15488758
GO:0005515	Function	Protein binding	IPI	1314164, 1330535, 1380456, 1382595, 7536927, 7537096, 7568038, 7584133, 7589433, 7642582, 7657594, 7680095, 7680644, 7692233, 7782332, 7797556, 7807015, 8146197, 8183372, 8226808, 8276809, 8382612, 8564419, 8603569, 8670861, 8961927, 9153411, 9160881, 9178760, 9223670, 9398332, 9417079
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IDA	20348923
GO:0005737	Component	Cytoplasm	IEA
GO:0005801	Component	Cis-Golgi network	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0005942	Component	Phosphatidylinositol 3-kinase complex	ISS
GO:0005943	Component	Phosphatidylinositol 3-kinase complex, class IA	IBA
GO:0005943	Component	Phosphatidylinositol 3-kinase complex, class IA	IEA
GO:0005943	Component	Phosphatidylinositol 3-kinase complex, class IA	IPI	19805105, 20713702, 28108251
GO:0005943	Component	Phosphatidylinositol 3-kinase complex, class IA	ISS
GO:0005943	Component	Phosphatidylinositol 3-kinase complex, class IA	NAS	20379207
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006955	Process	Immune response	NAS	27616589
GO:0007162	Process	Negative regulation of cell adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0010592	Process	Positive regulation of lamellipodium assembly	IEA
GO:0010592	Process	Positive regulation of lamellipodium assembly	ISS
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0019207	Function	Kinase regulator activity	IEA
GO:0019209	Function	Kinase activator activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IGI	7782332
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	14699157
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	NAS	20200404
GO:0030217	Process	T cell differentiation	NAS	17371229
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IDA	27708159
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0033120	Process	Positive regulation of RNA splicing	IMP	20348923
GO:0034143	Process	Regulation of toll-like receptor 4 signaling pathway	IDA	19289601
GO:0034446	Process	Substrate adhesion-dependent cell spreading	ISS
GO:0034644	Process	Cellular response to UV	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	20348923
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	ISS
GO:0035014	Function	Phosphatidylinositol 3-kinase regulator activity	IDA	27708159
GO:0035014	Function	Phosphatidylinositol 3-kinase regulator activity	ISS
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IMP	21321938
GO:0036312	Function	Phosphatidylinositol 3-kinase regulatory subunit binding	IEA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	16582911
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	20348923
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	20348923
GO:0043125	Function	ErbB-3 class receptor binding	IDA	10572067
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	7782332
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	21321938
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	ISS
GO:0043559	Function	Insulin binding	IDA	8440175
GO:0043560	Function	Insulin receptor substrate binding	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20348923
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046326	Process	Positive regulation of D-glucose import	ISS	8052599
GO:0046854	Process	Phosphatidylinositol phosphate biosynthetic process	ISS
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	IBA
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IDA	7782332
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IEA
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IPI	7541045
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IMP	21321938
GO:0050821	Process	Protein stabilization	IDA	20348923
GO:0051491	Process	Positive regulation of filopodium assembly	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	ISS
GO:0051492	Process	Regulation of stress fiber assembly	IEA
GO:0051497	Process	Negative regulation of stress fiber assembly	IEA
GO:0051497	Process	Negative regulation of stress fiber assembly	ISS
GO:0052742	Function	Phosphatidylinositol kinase activity	ISS
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	7782332
GO:0061470	Process	T follicular helper cell differentiation	IDA	30523347
GO:0097529	Process	Myeloid leukocyte migration	IEA
GO:0120183	Process	Positive regulation of focal adhesion disassembly	IEA
GO:0120183	Process	Positive regulation of focal adhesion disassembly	ISS
GO:0140767	Function	Enzyme-substrate adaptor activity	ISS	1322797
GO:0141038	Function	Phosphatidylinositol 3-kinase activator activity	ISS
GO:1900103	Process	Positive regulation of endoplasmic reticulum unfolded protein response	IMP	20348923
GO:1903076	Process	Regulation of protein localization to plasma membrane	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	ISS	8052599
GO:1990578	Component	Perinuclear endoplasmic reticulum membrane	IEA

MIM	HGNC	e!Ensembl
171833	8979	ENSG00000145675

P27986

Protein name

Phosphatidylinositol 3-kinase regulatory subunit alpha (PI3-kinase regulatory subunit alpha) (PI3K regulatory subunit alpha) (PtdIns-3-kinase regulatory subunit alpha) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha) (PI3-kinase subunit p85

Protein function

Binds to activated (phosphorylated) protein-Tyr kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Necessary for the insulin-stimulated increase in glucose uptake

PDB

1A0N , 1AZG , 1H9O , 1PBW , 1PHT , 1PIC , 1PKS , 1PKT , 2IUG , 2IUH , 2IUI , 2RD0 , 2V1Y , 3HHM , 3HIZ , 3I5R , 3I5S , 4A55 , 4JPS , 4L1B , 4L23 , 4L2Y , 4OVU , 4OVV , 4WAF , 4YKN , 4ZOP , 5AUL , 5FI4 , 5GJI , 5ITD , 5M6U , 5SW8 , 5SWG , 5SWO , 5SWP , 5SWR , 5SWT , 5SX8 , 5SX9 , 5SXA , 5SXB , 5SXC , 5SXD , 5SXE , 5SXF , 5SXI , 5SXJ , 5SXK , 5UBT , 5UK8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00620	RhoGAP	129 → 282	RhoGAP domain	Domain
PF00017	SH2	333 → 408	SH2 domain	Domain
PF16454	PI3K_P85_iSH2	431 → 599	Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain	Domain
PF00017	SH2	624 → 698	SH2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 2 is expressed in skeletal muscle and brain, and at lower levels in kidney and cardiac muscle. Isoform 2 and isoform 4 are present in skeletal muscle (at protein level). {ECO:0000269|PubMed:8628286}.

Sequence

MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE
QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH
VLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR

Sequence length

724

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance Endocrine resistance Platinum drug resistance ErbB signaling pathway Ras signaling pathway Rap1 signaling pathway cAMP signaling pathway Chemokine signaling pathway HIF-1 signaling pathway FoxO signaling pathway Phosphatidylinositol signaling system Sphingolipid signaling pathway Phospholipase D signaling pathway Hormone signaling Autophagy - animal mTOR signaling pathway PI3K-Akt signaling pathway AMPK signaling pathway Apoptosis Longevity regulating pathway Longevity regulating pathway - multiple species Cellular senescence Axon guidance VEGF signaling pathway Osteoclast differentiation Focal adhesion Signaling pathways regulating pluripotency of stem cells Platelet activation Neutrophil extracellular trap formation Toll-like receptor signaling pathway C-type lectin receptor signaling pathway JAK-STAT signaling pathway Natural killer cell mediated cytotoxicity T cell receptor signaling pathway B cell receptor signaling pathway Fc epsilon RI signaling pathway Fc gamma R-mediated phagocytosis TNF signaling pathway Leukocyte transendothelial migration Neurotrophin signaling pathway Cholinergic synapse Inflammatory mediator regulation of TRP channels Regulation of actin cytoskeleton Insulin signaling pathway Progesterone-mediated oocyte maturation Estrogen signaling pathway Prolactin signaling pathway Thyroid hormone signaling pathway Regulation of lipolysis in adipocytes Relaxin signaling pathway GnRH secretion Type II diabetes mellitus Insulin resistance Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Growth hormone synthesis, secretion and action Aldosterone-regulated sodium reabsorption Carbohydrate digestion and absorption Alzheimer disease Spinocerebellar ataxia Prion disease Bacterial invasion of epithelial cells Shigellosis Yersinia infection Chagas disease Amoebiasis Hepatitis C Hepatitis B Measles Human cytomegalovirus infection Influenza A Human papillomavirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Pathways in cancer Viral carcinogenesis Proteoglycans in cancer MicroRNAs in cancer Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Colorectal cancer Renal cell carcinoma Pancreatic cancer Endometrial cancer Glioma Prostate cancer Melanoma Chronic myeloid leukemia Acute myeloid leukemia Small cell lung cancer Non-small cell lung cancer Breast cancer Hepatocellular carcinoma Gastric cancer Central carbon metabolism in cancer Choline metabolism in cancer PD-L1 expression and PD-1 checkpoint pathway in cancer Diabetic cardiomyopathy Lipid and atherosclerosis Fluid shear stress and atherosclerosis		PI3K Cascade IRS-mediated signalling GPVI-mediated activation cascade Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants PI3K events in ERBB4 signaling PIP3 activates AKT signaling Interleukin-7 signaling Signaling by SCF-KIT Synthesis of PIPs at the plasma membrane GAB1 signalosome Signaling by cytosolic FGFR1 fusion mutants Downstream signal transduction PI3K events in ERBB2 signaling PI3K/AKT activation Downstream TCR signaling Role of phospholipids in phagocytosis Tie2 Signaling Constitutive Signaling by Aberrant PI3K in Cancer DAP12 signaling Role of LAT2/NTAL/LAB on calcium mobilization Costimulation by the CD28 family CD28 dependent PI3K/Akt signaling G alpha (q) signalling events GP1b-IX-V activation signalling VEGFA-VEGFR2 Pathway Interleukin-3, Interleukin-5 and GM-CSF signaling Constitutive Signaling by EGFRvIII PI-3K cascade:FGFR1 PI-3K cascade:FGFR2 PI-3K cascade:FGFR3 PI-3K cascade:FGFR4 Signaling by FGFR2 in disease Signaling by FGFR4 in disease Signaling by FGFR1 in disease Interleukin-4 and Interleukin-13 signaling PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling MET activates PI3K/AKT signaling Signaling by FGFR3 fusions in cancer Signaling by FGFR3 point mutants in cancer RET signaling Extra-nuclear estrogen signaling Erythropoietin activates Phosphoinositide-3-kinase (PI3K) Interleukin receptor SHC signaling Regulation of signaling by CBL Signaling by ERBB2 KD Mutants Signaling by ERBB2 ECD mutants Signaling by PDGFRA transmembrane, juxtamembrane and kinase domain mutants Signaling by PDGFRA extracellular domain mutants Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (18)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Agammaglobulinemia 7, autosomal recessive	Pathogenic; Likely pathogenic	rs367669362, rs1230037871, rs1339790364, rs1289537429, rs2112261986, rs587777709, rs2530954124, rs1389187507, rs2531001766, rs2112253467, rs2531001005, rs2531001159, rs2531010723, rs1057519838, rs1554051075 View all (5 more)	RCV001384927 RCV001877177 RCV001999758 RCV001898266 RCV002031764 View all (18 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CLOVES syndrome	Likely pathogenic; Pathogenic	rs2112277098, rs1747645807, rs751582616	RCV002221174 RCV002226776 RCV002221158	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colon adenocarcinoma	Pathogenic	rs1747658551	RCV005866921	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colorectal cancer	Likely pathogenic; Pathogenic	rs1289537429	RCV001293839	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Diffuse pediatric-type high-grade glioma, H3-wildtype and IDH-wildtype	Likely pathogenic	rs1747645807	RCV006254262	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gastric cancer	Likely pathogenic; Pathogenic	rs587777709	RCV005900666	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
IDH-wildtype glioblastoma	Pathogenic	rs1057519841	RCV006253995	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunodeficiency 36 with lymphoproliferation	Pathogenic; Likely pathogenic	rs367669362, rs1230037871, rs1339790364, rs1289537429, rs2112261986, rs587777709, rs2530954124, rs1389187507, rs2531001766, rs2112253467, rs2531001005, rs2531001159, rs2531010723, rs1057519838, rs1554051075 View all (8 more)	RCV001384927 RCV001877177 RCV001999758 RCV001898266 RCV002031764 View all (22 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Inherited Immunodeficiency Diseases	Likely pathogenic; Pathogenic	rs587777709, rs1403833564, rs1580262965	RCV001027613 RCV001027611 RCV001027612	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lymphoma	Likely pathogenic	rs1403833564	RCV005912402	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Melanoma	Pathogenic	rs1554051075	RCV005901104	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Pathogenic; Likely pathogenic	rs1057519757, rs1057519841, rs1561299903, rs1747530144	RCV005230293 RCV006273726 RCV006273990 RCV005232239	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Overgrowth syndrome	Pathogenic; Likely pathogenic	rs761402403, rs1747530144	RCV003493323 RCV003458224	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PIK3R1-related disorder	Pathogenic; Likely pathogenic	rs367669362, rs2112278418, rs587777709	RCV003399205 RCV003402837 RCV003922673	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SHORT syndrome	Pathogenic; Likely pathogenic	rs367669362, rs1230037871, rs1339790364, rs1289537429, rs2112261986, rs587777709, rs2112197421, rs773461483, rs587784325, rs797045063, rs2530954124, rs1389187507, rs2531001766, rs2112253467, rs2531001005 View all (15 more)	RCV001384927 RCV001877177 RCV001999758 RCV001898266 RCV002031764 View all (29 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Squamous cell lung carcinoma	Likely pathogenic	rs1403833564	RCV005912401	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Vascular malformation	Likely pathogenic; Pathogenic	rs2531001936, rs1057519841	RCV004566495 RCV003458427	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Vascular Malformations and Overgrowth	Pathogenic; Likely pathogenic	rs1057519757, rs1057519841, rs1131692243, rs1747528071, rs1747530144, rs1747645807, rs751582616, rs1747658551, rs1747658707	RCV001290349 RCV001290352 RCV001290357 RCV001290350 RCV001290351 View all (4 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (43)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Activated PI3K-delta syndrome	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL AGAMMAGLOBULINEMIA	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL NON-SYNDROMIC AGAMMAGLOBULINEMIA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BURKITT LYMPHOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL LIPOMATOUS OVERGROWTH, VASCULAR MALFORMATIONS, AND EPIDERMAL NEVI	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE IDIOPATHIC SKELETAL HYPEROSTOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma susceptibility 1	Uncertain significance; -	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 36	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple congenital anomalies/dysmorphic syndrome	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance; -	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (382)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ACTIVATED PI3K-DELTA SYNDROME	ACTIVATED PI3K-DELTA SYNDROME	ORPHANET_DG	25133428		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Activated PI3K-delta syndrome	ACTIVATED PI3K-DELTA SYNDROME	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ACTIVATED PI3K-DELTA SYNDROME	ACTIVATED PI3K-DELTA SYNDROME	BEFREE	27116393, 27616589, 28167755		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Adenocarcinoma	Adenocarcinoma	BEFREE	1310887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	21077741		★★★★★ ★☆☆☆☆ Found in Text Mining only
African Burkitt`s lymphoma	African Burkitt`s Lymphoma	CTD_human_DG	23143597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	BEFREE	22351933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	25133428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	GENOMICS_ENGLAND_DG	25488983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
AGAMMAGLOBULINEMIA 7, AUTOSOMAL RECESSIVE	Agammaglobulinemia	CLINVAR_DG	22351933, 23810378, 23810379, 23810382, 23980586, 24886349, 25133428, 25326637, 25488983, 26529633, 26974159, 27766312, 28632845		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AGAMMAGLOBULINEMIA 7, AUTOSOMAL RECESSIVE	Agammaglobulinemia	GENOMICS_ENGLAND_DG	22351933, 25488983		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AGAMMAGLOBULINEMIA 7, AUTOSOMAL RECESSIVE	Agammaglobulinemia	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Agammaglobulinemia, non-Bruton type	Agammaglobulinemia	ORPHANET_DG	22351933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alagille Syndrome	Alagille syndrome	Pubtator	23810378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12185156, 16014629, 28558704, 32192109, 36530083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	12185156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	32719259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12606953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	37012663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22261810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Argininosuccinic Aciduria	Argininosuccinic aciduria	Pubtator	23807225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11822409, 11879539, 12105209, 12115180, 12937131, 17101049, 18787303, 20187936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25871513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	12356354, 21263009, 26286747, 29016839, 37667984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	26286747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	10222145, 10500142, 8659541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26196376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal agammaglobulinemia	Agammaglobulinemia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	20888662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24004856, 24367658, 31401412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	32626985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	10666407, 23243278, 39812346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	28969385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	26722465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16579640, 23222510, 24229379, 26676464, 27314662, 28027535, 28394344, 28478612, 28630349, 29527004, 30128822, 31209687, 31660072, 31777591		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	10542266, 11328805, 11689575, 12048182, 12477728, 12771144, 14602723, 14704150, 15367412, 15846085, 16168140, 17121430, 17649772, 17690101, 17951403 View all (66 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27314662	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brittle cornea syndrome 1	Brittle cornea syndrome	Pubtator	28143957, 29476696, 39735640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	GENOMICS_ENGLAND_DG	29556229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	CTD_human_DG	23143597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	CTD_human_DG	23143597		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	23143597, 29669863	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15353558, 18831514, 20173732, 20664599, 22146979, 24098937, 24132918, 24423924, 29636477, 30536312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	19588205, 19651067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12606953		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	17823122	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	27738081, 29946183		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	15610530, 19055754, 36788083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	23609359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26045339, 40462124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10438468, 12896980, 24103747, 24135379, 24223153, 24556693, 25091573, 26045814, 27918554, 28347229, 29208003, 29970718, 30497511, 32271415, 33929972 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17609269	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	31734230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26718977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	25601220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	26981779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24004856, 24367658, 31401412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	27002759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	1310887, 23980150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34162426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22261810, 25846727, 35887266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21834980, 25784113, 28718916, 29506494, 37024452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25757764	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21986939, 31035650, 32991423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12606953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	25233892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33015184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	12796566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23609359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	29893513, 34077942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carnitine Palmitoyltransferase II Deficiency Infantile	Carnitine palmitoyltransferase deficiency	Pubtator	28566443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	27701424, 32322000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31894261, 32626985, 38013375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23832540	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22623730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	26795696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36530083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	22351933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	29794741, 36232773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18245521, 25314071, 26864651, 7541019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	28714374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23990352, 30675279, 31217502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12140294, 16150444, 16543245, 18064605, 18663744, 19018265, 19351759, 19596916, 20421047, 21909943, 21978709, 22026957, 22710713, 22851869, 23594372 View all (20 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	GENOMICS_ENGLAND_DG	25488983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	35990641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital bilateral aplasia of vas deferens	Congenital bilateral absence of vas deferens	Pubtator	32054096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1L	Congenital disorder of glycosylation	Pubtator	9821957	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital keratoglobus	Congenital Keratoglobus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25757764, 29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30844764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26972586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	28143957, 29476696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29476696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	24452877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	14551916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	22893718, 24507683, 30805369, 35613088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	39684804	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	14551916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	14551916, 23810378, 37522815, 40420664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36303457, 39464889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	12185156, 14551916, 19581418, 23133645, 29893513, 33149760, 36504295, 38003949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10768097, 12185156, 15127203, 15523593, 28386332, 29893513		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	38374020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25754093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	38194422	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	11483649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	28143957, 28632845, 29476696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27766312, 30212470		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	21478295, 25701704, 26374646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24452877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	24467828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21478295, 21984976, 22146979, 22586352, 23674493, 26626801, 29636360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17213663, 19154413, 19261849, 19878980, 20681032, 21478295, 21816851, 21984976, 22146979, 23028188, 23674493, 26825822, 28485815, 31527078, 31880826 View all (7 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	24573554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35124383	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35285386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis bullosa	Pubtator	34536484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythrocytosis familial, 1	Erythrocytosis	BEFREE	19336760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27893424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25337715, 27893424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	20888662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	26947513, 32925281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	36906972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	32863943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	18521081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	32321919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	31680442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	14655756, 14701753, 15605984, 18260157, 18772890, 19458076, 20935218, 21419810, 21430111, 21649900, 22064833, 22156546, 23166678, 24378652, 26125228 View all (12 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15605984, 18328427, 18772890, 23166678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18328427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15605984, 18328427, 18772890, 22064833, 23166678		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	CGI_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	11238734, 16170333, 19671762, 19894763, 21419810, 23727752, 26151295, 26699864, 27633132, 27852048, 28759109, 30296359, 31036078, 33942853, 34106407, 37524847, 39780215 View all (2 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	27852048, 30715630		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CGI_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Developmental Delay	BEFREE	29953879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	21828034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	23810378, 23810379, 27076228, 28143957, 29476696, 33129256, 39735640, 40420664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29496059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23408298, 28476872, 30556200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37092838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	31305404, 32123305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	36906972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	16645590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	Pubtator	22729223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	17072986, 31541079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	17616457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22460814, 23895914, 24186142, 26577839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	28205613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11986952, 21077741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	16412023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyper-IgM Immunodeficiency Syndrome, Type 1	Hyper-IgM Immunodeficiency Syndrome	BEFREE	27076228, 30799802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	15964918, 28727815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	23316693, 28386332, 28727815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperimmunoglobulin M syndrome	Hyperimmunoglobulin M Syndrome	BEFREE	27076228, 30799802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31658172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersplenism	Hypersplenism	BEFREE	20846792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32888289, 37561089	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypodontia	Hypodontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	26529633, 27693481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of iris	Hypoplasia Of Iris	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotrichosis	Hypotrichosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12764143, 15802268, 19349275, 29898734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16543245, 17158959	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	27076228, 35080319, 35486341, 39620215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 36	Immunodeficiency	CLINVAR_DG	22351933, 23810378, 23810379, 23810382, 23980586, 24886349, 25133428, 25326637, 25488983, 26529633, 26974159, 27766312, 28632845		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 36	Immunodeficiency	GENOMICS_ENGLAND_DG	25488983, 29556229		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 36	Immunodeficiency	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	25133419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36303457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	36608061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	11707433, 12185156, 15339744, 19581418, 23810378, 29476696, 29893513, 31389668, 33742773, 35110500, 36504295, 39735640, 40420664, 9486982	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin-resistant diabetes mellitus	Insulin-resistant diabetes mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31715311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	24469048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	25757764, 28713889, 28829506, 39780215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	27002759, 36033826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	19464003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12855588, 17949889, 19375649, 19406989, 21789382, 28596424, 28704451, 30185437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25299784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	26941398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17878402, 19805619, 20811632, 24189654, 24935396, 26941398, 28008177, 30760869, 32993794, 35240791, 37689825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24189654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	28292967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	23810378, 24033310, 31583022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	23810378, 23810379, 24033310, 31583022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	23810379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy Familial Partial	Lipodystrophy	Pubtator	23810379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17486587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25475121, 25962360, 30497511, 30561038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	17599743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27458792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	29328793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12714585, 17032498, 19483050, 20375364, 24533074, 30485130, 34390443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25989537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26637226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	34040190, 34887309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16946303, 23603894, 39735560	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lymphoma Follicular	Lymphoma	Pubtator	16912221, 19321861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	34382383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	11815622, 32321919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	11986952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	9538131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29496059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23222510, 24229379, 26676464, 27314662, 28027535, 28394344, 28478612, 28630349, 29527004, 30128822, 31209687, 31660072, 31777591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21478295, 21984976, 22146979, 22586352, 26626801, 29636360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28829506, 29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	27002759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20530665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	1310887, 23980150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30630630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20407443, 28012929, 28614092, 28676490, 31428587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475, 29662167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30927924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24004856, 24367658, 31401412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11606375, 16131837, 18245521, 21984976, 23270540, 23619167, 24004856, 24367658, 24459181, 26565021, 26657142, 27633132, 27827005, 28143957, 28351303 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18245521, 25314071, 26864651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Uterine Corpus Neoplasm	Malignant Uterine Corpus Neoplasm	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14769856, 16168140, 17006756, 18990689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28630349, 29527004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	34635507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16815849, 19088048, 19383818, 21169255, 22589389, 22912864, 25956405, 26302068, 31980996, 33549048, 33744299, 34241580, 36303457, 8823367	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
melanoma	Melanoma	BEFREE	25746038		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Meningioma	Meningioma	Pubtator	27548314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29476696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesangial sclerosis diffuse	Diffuse mesangial sclerosis	Pubtator	11918736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28223140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	18096084, 23817184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	31677333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24555840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	26529633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microdontia (disorder)	Microdontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	23810378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	9857977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	30556200, 31318643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11751905, 12433678, 14717778, 15010462, 15319277, 16627469, 18499442, 19286672, 20709908, 23522020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19286672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23469041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21789382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	17440089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	32047813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26581613, 29393436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29409973, 30662656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16917505, 21221997, 21984976, 22064833, 22261810, 23166678, 26122737, 26676464, 26807692, 27130196, 27748875, 27827005, 28394344, 28630349, 29588411 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CLINVAR_DG	19962457, 24459181, 25157968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	28326956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10501184, 11228049, 11274155, 12000752, 17379415, 18281552, 19211844, 9414036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23232578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	31730023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	23434321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23728071, 24550137, 31402930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27314662	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29893513, 32599690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypotension	Ocular hypotension	Pubtator	39735640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	19011679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	26972586, 27701424, 31486697, 37058031, 37788787	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	32124937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30212470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23133552, 25512523, 30657552, 34903122, 37211864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	23810378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	24058690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15028555, 17070899, 17900261, 20081105, 20487263, 20826764, 21559368, 22556379, 22585163, 23408974, 24176845, 28728166, 28888422, 29909423, 30084434 View all (8 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19050262, 20848249, 22170433, 23918833, 25846727, 31059194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	12865943	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	37461070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36595764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Partial lipodystrophy	Partial Lipodystrophy	BEFREE	23810379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	11440917, 18249389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	19336760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	20846792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior embryotoxon	Posterior embryotoxon	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	31111319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	18829572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20407443, 28012929, 28614092, 28676490, 31428587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12582030, 18372911		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15548330, 16061480, 16728406, 17823122, 17876045, 18372911, 18611860, 19725049, 20197460, 20368692, 20412587, 20606040, 20971737, 21080918, 21310825 View all (22 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	20407443		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475, 29662167		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	24303025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	25243493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28522564, 38178680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28829506, 29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25757764, 29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	27178332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	27221134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29016839, 29059158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	37430199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rieger eye malformation sequence	Axenfeld anomaly	BEFREE	23810378, 23810379, 28632845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rieger eye malformation sequence	Axenfeld anomaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rieger syndrome	Rieger syndrome	BEFREE	23810378, 23810379, 28632845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rieger syndrome	Rieger syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	26247885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	40462124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	17409416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	11994280, 30170375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	25133419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	25133419, 37475052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SHORT syndrome	SHORT Syndrome	CLINGEN_DG	11062485, 16847462, 23810378, 23810379, 23810382		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SHORT syndrome	SHORT Syndrome	GENOMICS_ENGLAND_DG	22351933, 23810378, 25488983		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SHORT syndrome	SHORT Syndrome	CLINVAR_DG	22351933, 23810378, 23810379, 23810382, 23980586, 24886349, 25133428, 25326637, 25488983, 26529633, 26633545, 26974159, 27766312, 28632845		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SHORT syndrome	SHORT Syndrome	ORPHANET_DG	23810378, 23810379, 23810382		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SHORT syndrome	SHORT Syndrome	UNIPROT_DG	23810378, 23810379, 23810382		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SHORT syndrome	Short syndrome	Pubtator	23810378, 23810379, 23810382, 24886349, 27076228, 28143957, 29476696, 32546215, 33129256, 33742773, 35110500, 39735640, 40420664, 40420722	Associate	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SHORT syndrome	SHORT Syndrome	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SHORT syndrome	SHORT Syndrome	BEFREE	23810382, 23980586, 24033310, 24886349, 28143957, 28302518, 28632845, 28934384, 29724723, 31583022		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SHORT syndrome	SHORT Syndrome	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Sinusitis	Sinusitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	39819714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	26988918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12927054, 26988918, 28280736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Spastic paraplegia	Pubtator	30081747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 15 autosomal recessive	Spastic paraplegia	Pubtator	30081747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25654238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23619167, 23730900, 25622907, 26614708, 26895469, 30556200, 30858165, 32823607, 33527763, 33811778, 37486536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34098850	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30927924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19143835, 20848249, 25085584, 25590580, 25724188, 28460635, 30024601, 30106120, 33431761, 34504059, 34554347, 35670774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	32626985, 37561089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	36355435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	31450639, 35456471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	23243278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	20564403, 26637226, 31696481, 31902939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	33129256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22928011, 28042956, 32737449, 34911834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	33174521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tooth Abnormalities	Tooth abnormalities	Pubtator	28143957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29527004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30272286, 31527768, 31804921, 32672423, 33059724, 33092442, 36870308, 38202644, 39819723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29794741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12606953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	16984382, 21523767, 24004856, 25266796, 27350368, 31199921, 35246010, 38200039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29665744, 31401412	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	21533174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Usher Syndromes	Usher syndrome	Pubtator	31781101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21663621, 27489350, 30075505, 30132534, 30283446, 31295843, 31983729, 34216514, 35296731, 36305754, 36906972, 38056236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	30008023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	37641480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Malformations	Vascular malformation	Pubtator	34040190, 37641480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	CTD_human_DG	28836394		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	Pubtator	31941556	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	15988409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	25133419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Young Syndrome	Young syndrome	Pubtator	25488983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PIK3R1 (phosphoinositide-3-kinase regulatory subunit 1)