Gene Gene information from NCBI Gene database.
Entrez ID 5277
Gene name Phosphatidylinositol glycan anchor biosynthesis class A
Gene symbol PIGA
Synonyms (NCBI Gene)
GPI3MCAHS2NEDEPHPIG-APNH1
Chromosome X
Chromosome location Xp22.2
Summary This gene encodes a protein required for synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), the first intermediate in the biosynthetic pathway of GPI anchor. The GPI anchor is a glycolipid found on many blood cells and which serves to anc
SNPs SNP information provided by dbSNP.
26
SNP ID Visualize variation Clinical significance Consequence
rs199422232 G>T Pathogenic Upstream transcript variant, genic upstream transcript variant, intron variant, non coding transcript variant, coding sequence variant, stop gained
rs199422233 G>A Pathogenic Upstream transcript variant, genic upstream transcript variant, intron variant, non coding transcript variant, coding sequence variant, stop gained
rs201119959 T>A,C Uncertain-significance, pathogenic Upstream transcript variant, genic upstream transcript variant, intron variant, coding sequence variant, missense variant
rs387906726 G>A,T Likely-benign, pathogenic Non coding transcript variant, synonymous variant, stop gained, coding sequence variant
rs587776723 A>- Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
473
miRTarBase ID miRNA Experiments Reference
MIRT028798 hsa-miR-26b-5p Microarray 19088304
MIRT043655 hsa-miR-326 CLASH 23622248
MIRT566430 hsa-miR-548e-5p PAR-CLIP 20371350
MIRT566429 hsa-miR-548p PAR-CLIP 20371350
MIRT566428 hsa-miR-16-1-3p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IBA
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IDA 16162815
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IEA
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IPI 16162815
GO:0005515 Function Protein binding IPI 8900170, 9463366, 10944123, 16162815, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
311770 8957 ENSG00000165195
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P37287
Protein name Phosphatidylinositol N-acetylglucosaminyltransferase subunit A (EC 2.4.1.198) (GlcNAc-PI synthesis protein) (Phosphatidylinositol-glycan biosynthesis class A protein) (PIG-A)
Protein function Catalytic subunit of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex that catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol and participates in the first step of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08288 PIGA 72 161 PIGA (GPI anchor biosynthesis) Family
PF00534 Glycos_transf_1 214 371 Glycosyl transferases group 1 Family
Sequence
MACRGGAGNGHRASATLSRVSPGSLYTCRTRTHNICMVSDFFYPNMGGVESHIYQLSQCL
IERGHKVIIVTHAYGNRKGIRYLTSGLKVYYLPLKVMYNQSTATTLFHSLPLLRYIFVRE
RVTIIHSHSSFSAMAHDALFHAKTMGLQTVFTDHSLFGFAD
VSSVLTNKLLTVSLCDTNH
IICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGI
DLLSGIIPELCQKYPDLNFIIGGEGPKRIILEEVRERYQLHDRVRLLGALEHKDVRNVLV
QGHIFLNTSLTEAFCMAIVEAASCGLQVVSTRVGGIPEVLPENLIILCEPSVKSLCEGLE
KAIFQLKSGTL
PAPENIHNIVKTFYTWRNVAERTEKVYDRVSVEAVLPMDKRLDRLISHC
GPVTGYIFALLAVFNFLFLIFLRWMTPDSIIDVAIDATGPRGAWTNNYSHSKRGGENNEI
SETR
Sequence length 484
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
Metabolic pathways
  Synthesis of glycosylphosphatidylinositol (GPI)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
35
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Epileptic encephalopathy Likely pathogenic rs2519326142 RCV003484990
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple congenital anomalies-hypotonia-seizures syndrome 2 Likely pathogenic; Pathogenic rs1922179572, rs1921924356, rs2147714706, rs587777396, rs587777397, rs587777398, rs201119959, rs587777399, rs587777400, rs2147723760, rs2519331818, rs2519331917, rs2519324834, rs1060499625, rs387906726
View all (7 more)
RCV001330748
RCV001775167
RCV001374411
RCV000119283
RCV000119284
View all (17 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodevelopmental disorder with epilepsy and hemochromatosis Pathogenic; Likely pathogenic rs587777399, rs2147723740, rs587777398 RCV002221150
RCV002221186
RCV002221259
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nonpapillary renal cell carcinoma Pathogenic; Likely pathogenic rs2147717286, rs2519326142 RCV005887414
RCV005927747
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLD PAROXYSMAL HEMOGLOBINURIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Absence of septum pellucidum Absence Of Septum Pellucidum HPO_DG
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Of Esophagus Esophageal Cancer BEFREE 30914682
★☆☆☆☆
Found in Text Mining only
Anemia Aplastic Aplastic anemia Pubtator 10086790, 10233366, 12424196, 22315493, 25800665, 26132940, 8541558, 8619404, 9163589 Associate
★☆☆☆☆
Found in Text Mining only
Anemia, Hemolytic Anemia HPO_DG
★☆☆☆☆
Found in Text Mining only
Anemia, Hemolytic, Acquired Anemia BEFREE 11301179, 19074066, 8541557
★☆☆☆☆
Found in Text Mining only
Aplastic Anemia Aplastic anemia BEFREE 10086790, 10233366, 10233427, 11372733, 12424196, 12627846, 16467865, 22315493, 29974931, 8619404, 9163589
★☆☆☆☆
Found in Text Mining only
Aplastic Anemia Aplastic anemia LHGDN 12424196, 16923549
★☆☆☆☆
Found in Text Mining only
Aplastic Anemia Aplastic anemia HPO_DG
★☆☆☆☆
Found in Text Mining only
Atrial Septal Defects Atrial Septal Defect HPO_DG
★☆☆☆☆
Found in Text Mining only
Atypical Hemolytic Uremic Syndrome Hemolytic Uremic Syndrome BEFREE 25862562
★☆☆☆☆
Found in Text Mining only